Copy Link Print Information

GPR114 Protein, Human (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

GPR114, an adhesion G protein-coupled receptor (GPCR), crucially activates the adenylate cyclase pathway by coupling with G(s) subunit alpha. Isoform 1, displaying constitutive activity, elevates basal cyclic AMP (cAMP) levels and responds to mechanical stimulation, emphasizing GPR114's functional significance in intracellular signaling cascades and its role in cellular responses to mechanical cues. GPR114 Protein, Human (HEK293, Fc) is the recombinant human-derived GPR114 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • GPR114 Protein, Human (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

GPR114, an adhesion G protein-coupled receptor (GPCR), crucially activates the adenylate cyclase pathway by coupling with G(s) subunit alpha. Isoform 1, displaying constitutive activity, elevates basal cyclic AMP (cAMP) levels and responds to mechanical stimulation, emphasizing GPR114's functional significance in intracellular signaling cascades and its role in cellular responses to mechanical cues. GPR114 Protein, Human (HEK293, Fc) is the recombinant human-derived GPR114 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

GPR114 is an adhesion G protein-coupled receptor (GPCR) that plays a key role in signal transduction by coupling with the G(s) subunit alpha of guanine nucleotide-binding proteins and activating the adenylate cyclase pathway. Notably, isoform 1 exhibits constitutive activity, leading to elevated basal levels of cyclic AMP (cAMP), and demonstrates responsiveness to mechanical stimulation, such as shaking. This highlights the functional significance of GPR114 in mediating intracellular signaling cascades and suggests its involvement in cellular responses to mechanical cues.

Verified Bioactivity

Measured by the ability of the immobilized protein to enhance the adhesion of U251 human glioblastoma cells to human Fibronectin. When 4 x 104 cells/well are added to plates coated with human Fibronectin (0.1 µg/mL) and rhGPR114 (10µg/well, 100µL/well) for 45 minutes at 37 °C, there is a 2.1 fold increase in adhesion to human fibronectin induced by the presence of rhGPR114.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession

    Q8IZF4 (E22-G184)

  • Gene ID
    221188  [NCBI]
  • Molecular Construction
    • N-term
    • GPR114 (E22-G184)
      Accession # Q8IZF4
    • hFc
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    ADGRG5; G Protein-Coupled Receptor 114; Prev. GPR114; G Protein-Coupled Receptor PGR27; PGR27; G-Protein Coupled Receptor PGR27; Adhesion G-Protein Coupled Receptor G5; G-Protein Coupled Receptor 114; Adhesion G Protein-Coupled Receptor G5; Probable G-Pro

  • AA Sequence

    ETWEELLSYMENMQVSRGRSSVFSSRQLHQLEQMLLNTSFPGYNLTLQTPTIQSLAFKLSCDFSGLSLTSATLKRVPQAGGQHARGQHAMQFPAELTRDACKTRPRELRLICIYFSNTHFFKDENNSSLLNNYVLGAQLSHGHVNNLRDPVNISFWHNQSLEG

  • Molecular Weight

    Approximately 56-63 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 10% trehalose, 0.02% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • GPR114 Protein, Human (HEK293, Fc) Product Image
    1/16
  • GPR114 Protein, Human (HEK293, Fc) Product Image