1. Recombinant Proteins
  2. Receptor Proteins
  3. GPVI Protein, Cynomolgus (HEK293, His)

GPVI protein is a collagen receptor that mediates collagen-induced platelet adhesion and activation and plays a crucial role in procoagulant activity, thrombin generation, and fibrin formation. GPVI Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived GPVI protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GPVI protein is a collagen receptor that mediates collagen-induced platelet adhesion and activation and plays a crucial role in procoagulant activity, thrombin generation, and fibrin formation. GPVI Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived GPVI protein, expressed by HEK293 , with C-His labeled tag.

Background

The GPVI protein functions as a collagen receptor crucially involved in mediating collagen-induced platelet adhesion and activation. It plays a pivotal role in platelet procoagulant activity, leading to subsequent thrombin and fibrin formation, thereby contributing to arterial and venous thrombus formation. The signaling pathway involves the FcR gamma-chain, the Src kinases (likely FYN or LYN), SYK, the adapter protein LAT, and culminates in the activation of PLCG2. GPVI is associated with the Fc receptor gamma chain, forming the GPVI:FcRgamma complex that is further linked to the Src kinase family FYN and LYN. Additionally, GPVI interacts with TRAF4 and specifically binds to COL1A1, highlighting its involvement in intricate signaling cascades and its association with collagen molecules, particularly COL1A1, which is integral to its collagen-binding function.

Species

Cynomolgus

Source

HEK293

Tag

C-8*His

Accession

XP_005590417.2 (Q21-N251)

Gene ID
Molecular Construction
N-term
GPVI (Q21-N251)
Accession # XP_005590417.2
8*His
C-term
Protein Length

Partial

Synonyms
GPVI; Gp6; Glycoprotein 6; MGC138168
AA Sequence

QRGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFIPAMKRHLAGRYRCSYQNGSLWSPPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSGDPYLWSAPSDPLELMVTEFSEATTELTVSLTNKVFTTETSRSITASPKEPGSPAGPTRQYYTKGN

Predicted Molecular Mass
26.4 kDa
Molecular Weight

Approximately 50-60 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

GPVI Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GPVI Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GPVI Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P700732
Quantity:
MCE Japan Authorized Agent: