GPVI Protein, Cynomolgus (HEK293, His)
GPVI protein is a collagen receptor that mediates collagen-induced platelet adhesion and activation and plays a crucial role in procoagulant activity, thrombin generation, and fibrin formation. GPVI Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived GPVI protein, expressed by HEK293 , with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GPVI protein is a collagen receptor that mediates collagen-induced platelet adhesion and activation and plays a crucial role in procoagulant activity, thrombin generation, and fibrin formation. GPVI Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived GPVI protein, expressed by HEK293 , with C-His labeled tag.
Background
The GPVI protein functions as a collagen receptor crucially involved in mediating collagen-induced platelet adhesion and activation. It plays a pivotal role in platelet procoagulant activity, leading to subsequent thrombin and fibrin formation, thereby contributing to arterial and venous thrombus formation. The signaling pathway involves the FcR gamma-chain, the Src kinases (likely FYN or LYN), SYK, the adapter protein LAT, and culminates in the activation of PLCG2. GPVI is associated with the Fc receptor gamma chain, forming the GPVI:FcRgamma complex that is further linked to the Src kinase family FYN and LYN. Additionally, GPVI interacts with TRAF4 and specifically binds to COL1A1, highlighting its involvement in intricate signaling cascades and its association with collagen molecules, particularly COL1A1, which is integral to its collagen-binding function.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-8*His
-
Accession
XP_005590417.2 (Q21-N251)
-
Molecular Construction
-
N-term
-
GPVI (Q21-N251)
Accession # XP_005590417.2 -
8*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
GP6; Glycoprotein VI (Platelet); Glycoprotein VI Platelet; Platelet Collagen Receptor; GPVI; BDPLT11; Platelet Glycoprotein VI; GPIV; Glycoprotein 6
-
AA Sequence
QRGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFIPAMKRHLAGRYRCSYQNGSLWSPPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSGDPYLWSAPSDPLELMVTEFSEATTELTVSLTNKVFTTETSRSITASPKEPGSPAGPTRQYYTKGN
-
Predicted Molecular Mass
26.4 kDa
-
Molecular Weight
Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
