GPX7 Protein, Human (HEK293, Fc)
Based on 1 Customer Validation
GPX7, a protein with catalase activity, is predicted to respond to oxidative stress. It is located in the endoplasmic reticulum and is expressed in various tissues, including placenta (RPKM 15.6) and thyroid (RPKM 9.2). This highlights the potential importance of GPX7 in antioxidative processes throughout the body. GPX7 Protein, Human (HEK293, Fc) is the recombinant human-derived GPX7 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GPX7, a protein with catalase activity, is predicted to respond to oxidative stress. It is located in the endoplasmic reticulum and is expressed in various tissues, including placenta (RPKM 15.6) and thyroid (RPKM 9.2). This highlights the potential importance of GPX7 in antioxidative processes throughout the body. GPX7 Protein, Human (HEK293, Fc) is the recombinant human-derived GPX7 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
GPX7, a protein endowed with catalase activity, is predicted to play a role in the cellular response to oxidative stress. Situated in the endoplasmic reticulum, GPX7 demonstrates ubiquitous expression across various tissues, including placenta (RPKM 15.6) and thyroid (RPKM 9.2), underscoring its potential significance in antioxidative processes throughout the body.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q96SL4/NP_056511.2 (Q20-L187)
-
Molecular Construction
-
N-term
-
GPX7 (Q20-L187)
Accession # Q96SL4/NP_056511.2 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
GPX7; GSHPx-7; Glutathione Peroxidase 7; CL683; GPX6; GPx-7; NPGPx; Non-Selenocysteine Containing Phospholipid Hydroperoxide Glutathione Peroxidase; FLJ14777; Glutathione Peroxidase 6
-
AA Sequence
QQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL
-
Molecular Weight
Approximately 48 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.5, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
