GPX7 Protein, Human (HEK293, Fc)

GPX7, a protein with catalase activity, is predicted to respond to oxidative stress. It is located in the endoplasmic reticulum and is expressed in various tissues, including placenta (RPKM 15.6) and thyroid (RPKM 9.2). This highlights the potential importance of GPX7 in antioxidative processes throughout the body. GPX7 Protein, Human (HEK293, Fc) is the recombinant human-derived GPX7 protein, expressed by HEK293 , with C-hFc labeled tag.

GPX7, a protein endowed with catalase activity, is predicted to play a role in the cellular response to oxidative stress. Situated in the endoplasmic reticulum, GPX7 demonstrates ubiquitous expression across various tissues, including placenta (RPKM 15.6) and thyroid (RPKM 9.2), underscoring its potential significance in antioxidative processes throughout the body.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

HEK293

C-hFc

Q96SL4/NP_056511.2 (Q20-L187)

2882  [NCBI]

Full Length of Mature Protein

QQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL

Approximately 47 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.5, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/nb69-cell.html