1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. GSTK1 Protein, Human

The GSTK1 protein acts as a glutathione S-transferase, promoting the binding of glutathione to exogenous and endogenous compounds, mainly through the model substrate 1-chloro-2,4-dinitrobenzene (CDNB). active activity. This enzymatic activity plays a vital role in the detoxification process, assisting in the binding of glutathione to various substrates. GSTK1 Protein, Human is the recombinant human-derived GSTK1 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg Get quote
250 μg Get quote
500 μg Get quote
1 mg Get quote
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GSTK1 protein acts as a glutathione S-transferase, promoting the binding of glutathione to exogenous and endogenous compounds, mainly through the model substrate 1-chloro-2,4-dinitrobenzene (CDNB). active activity. This enzymatic activity plays a vital role in the detoxification process, assisting in the binding of glutathione to various substrates. GSTK1 Protein, Human is the recombinant human-derived GSTK1 protein, expressed by E. coli , with tag free.

Background

GSTK1 (Glutathione S-transferase kappa 1) is an enzyme that belongs to the glutathione S-transferase family and is involved in the catalysis of glutathione conjugation to both exogenous and endogenous compounds. Its significant glutathione conjugating activity is particularly notable with the model substrate 1-chloro-2,4-dinitrobenzene (CDNB). This enzymatic activity suggests a role for GSTK1 in detoxification processes, where it facilitates the conjugation of glutathione to various xenobiotic and endogenous compounds, aiding in their elimination from the cell.

Biological Activity

Specific activity is 1.6842 units/mg, and is defined as the amount of enzyme that conjugate 1 μmole of 1- chloro-2,4-dinitrobenzene (CDNB) with reduced glutathione per minute at 37°C.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9Y2Q3-1 (G2-L226)

Gene ID
Molecular Construction
N-term
GSTK1 (G2-L226)
Accession # Q9Y2Q3-1
C-term
Protein Length

Partial

Synonyms
Glutathione S-transferase kappa 1; GST 13-13; GSTK1-1; Glutathione S-transferase subunit 13
AA Sequence

GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL

Molecular Weight

Approximately 25 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

1.Supplied as a 0.22 μm filtered solution of 50 mM Tris, 10% glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

GSTK1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GSTK1 Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GSTK1 Protein, Human
Cat. No.:
HY-P75800
Quantity:
MCE Japan Authorized Agent: