GSTK1 Protein, Human
Based on 1 Customer Validation
The GSTK1 protein acts as a glutathione S-transferase, promoting the binding of glutathione to exogenous and endogenous compounds, mainly through the model substrate 1-chloro-2,4-dinitrobenzene (CDNB). active activity. This enzymatic activity plays a vital role in the detoxification process, assisting in the binding of glutathione to various substrates. GSTK1 Protein, Human is the recombinant human-derived GSTK1 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The GSTK1 protein acts as a glutathione S-transferase, promoting the binding of glutathione to exogenous and endogenous compounds, mainly through the model substrate 1-chloro-2,4-dinitrobenzene (CDNB). active activity. This enzymatic activity plays a vital role in the detoxification process, assisting in the binding of glutathione to various substrates. GSTK1 Protein, Human is the recombinant human-derived GSTK1 protein, expressed by E. coli , with tag free.
Background
GSTK1 (Glutathione S-transferase kappa 1) is an enzyme that belongs to the glutathione S-transferase family and is involved in the catalysis of glutathione conjugation to both exogenous and endogenous compounds. Its significant glutathione conjugating activity is particularly notable with the model substrate 1-chloro-2,4-dinitrobenzene (CDNB). This enzymatic activity suggests a role for GSTK1 in detoxification processes, where it facilitates the conjugation of glutathione to various xenobiotic and endogenous compounds, aiding in their elimination from the cell.
Verified Bioactivity
Specific activity is 1.6842 units/mg, and is defined as the amount of enzyme that conjugate 1 μmole of 1- chloro-2,4-dinitrobenzene (CDNB) with reduced glutathione per minute at 37°C.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9Y2Q3-1 (G2-L226)
-
Molecular Construction
-
N-term
-
GSTK1 (G2-L226)
Accession # Q9Y2Q3-1 -
C-term
-
-
Protein Length
Full Length of Isoform-2
-
Synonyms
GSTK1; HGSTK1; Glutathione S-Transferase Kappa 1; Glutathione S-Transferase Subunit 13 Homolog; GST Class-Kappa; Glutathione S-Transferase Kappa; GST 13-13; Glutathione S-Transferase K1; GSTK1-1; GST13-13; GST13; GST; Glutathione S-Transferase Subunit 13
-
AA Sequence
GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
-
Molecular Weight
Approximately 25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
1.Supplied as a 0.22 μm filtered solution of 50 mM Tris, 10% glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
