HABP1/C1QBP Protein, Human (His)
Based on 1 Customer Validation
HABP1/C1QBP Protein, Human (His) is a recombinant human HABP1 (hyaluronan-binding protein 1)/C1QBP (complement component 1, q subcomponent binding protein) produced in HEK293 cells, with His tag. HABP1/C1QBP is a ubiquitously present glycoprotein having specific affinity towards hyaluronan (HA).
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
HABP1/C1QBP Protein, Human (His) is a recombinant human HABP1 (hyaluronan-binding protein 1)/C1QBP (complement component 1, q subcomponent binding protein) produced in HEK293 cells, with His tag. HABP1/C1QBP is a ubiquitously present glycoprotein having specific affinity towards hyaluronan (HA)[1].
Background
HABP1/C1QBP is a multi-functional, multicompartmental glycoprotein. HABP1/C1QBP shows distinct functions in cellular processes ranging from immunological response, splicing mechanism, sperm-oocyte interactions, and cell cycle regulation to cancer[1].
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q07021 (L74-Q282)
-
Molecular Construction
-
N-term
-
HABP1 (L74-Q282)
Accession # Q07021 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
C1QBP; Splicing Factor SF2-Associated Protein; Prev. HABP1; ASF/SF2-Associated Protein P32; Complement Component 1 Q Subcomponent-Binding Protein, Mitochondrial; Glycoprotein GC1qBP; Mitochondrial Matrix Protein P32; SF2AP32; Hyaluronan-Binding Protein 1;
-
AA Sequence
LHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ
-
Predicted Molecular Mass
24.9 kDa
-
Molecular Weight
Approximately 34 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filter solution of 20 mM Tris, 20% Glycerol, 1 mM DTT, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (261 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
