HER3 Protein, Rat (HEK293, Fc)
HER3 is a tyrosine-protein kinase that is a key cell surface receptor for neuregulin. ErbB2 and ErbB3 can form dimers and activate signaling pathways including MAPK, PI3K/Akt and PLC纬 to promote tumor development. HER3 Protein, Rat (HEK293, Fc) is the recombinant rat-derived HER3 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
HER3 is a tyrosine-protein kinase that is a key cell surface receptor for neuregulin. ErbB2 and ErbB3 can form dimers and activate signaling pathways including MAPK, PI3K/Akt and PLC纬 to promote tumor development. HER3 Protein, Rat (HEK293, Fc) is the recombinant rat-derived HER3 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
HER3 is a tyrosine protein-kinase that is a key cell surface receptor for neuregulin. Under the activation of neuregulin 1 (NRG1), ligand binding enhances the phosphorylation of tyrosine residues and facilitates their interaction with PI3K/p85. HER3 is involved in the regulation of myeloid differentiation and plays a key role in the cellular process of normal development and function. ErbB2 and ErbB3 can form dimers and activate signaling pathways including MAPK, PI3K/Akt and PLCγ to promote tumor development[1][2][3][4].
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-hFc
-
Accession
G3V6N1 (S20-H641)
-
Molecular Construction
-
N-term
-
HER3 (S20-H641)
Accession # G3V6N1 -
hFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
ERBB3; Receptor Protein-Tyrosine Kinase; Prev. LCCS2; P45-SErbB3; HER3; P85-SErbB3; V-Erb-B2 Avian Erythroblastic Leukemia Viral Oncogene Homolog 3; ErbB-3 R31; Tyrosine Kinase-Type Cell Surface Receptor HER3; MDA-BF-1; Human Epidermal Growth Factor Recep
-
AA Sequence
SEMGNSQAVCPGTLNGLSVTGDADNQYQTLYKLYEKCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSVLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLKFTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRVRGAEIVVKNNGANCPPCHEVCKGRCWGPGPDDCQILTKTICAPQCNGRCFGPNPNQCCHDECAGGCSGPQDTDCFACRRFNDSGACVPRCPEPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTFCVRACPPDKMEVDKHGLKMCEPCGGLCPKACEGTGSGSRYQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRVYISANQQLCYHHSLNWTRLLRGPSEERLDIKYNRPLGECLAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSREGVCVTHCNFLQGEPREFVHEAQCFSCHPECLPMEGTSTCNGSGSDACARCAHFRDGPHCVNSCPHGILGAKGPIYKYPDAQNECRPCHENCTQGCNGPELQDCLGQAEVLMSKPH
-
Predicted Molecular Mass
95.5 kDa
-
Molecular Weight
Approximately 115 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
