1. Recombinant Proteins
  2. Cytokines and Growth Factors CAR-T Related Proteins Receptor Proteins Enzymes & Regulators
  3. EGF Superfamily ErbB3/HER3 Receptor Tyrosine Kinases Cytokine Receptors Protein Tyrosine Kinases
  4. EGFR/ErbB family
  5. HER3 Protein, Rat (HEK293, Fc)

HER3 is a tyrosine-protein kinase that is a key cell surface receptor for neuregulin. ErbB2 and ErbB3 can form dimers and activate signaling pathways including MAPK, PI3K/Akt and PLC纬 to promote tumor development. HER3 Protein, Rat (HEK293, Fc) is the recombinant rat-derived HER3 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HER3 is a tyrosine-protein kinase that is a key cell surface receptor for neuregulin. ErbB2 and ErbB3 can form dimers and activate signaling pathways including MAPK, PI3K/Akt and PLC纬 to promote tumor development. HER3 Protein, Rat (HEK293, Fc) is the recombinant rat-derived HER3 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

HER3 is a tyrosine protein-kinase that is a key cell surface receptor for neuregulin. Under the activation of neuregulin 1 (NRG1), ligand binding enhances the phosphorylation of tyrosine residues and facilitates their interaction with PI3K/p85. HER3 is involved in the regulation of myeloid differentiation and plays a key role in the cellular process of normal development and function. ErbB2 and ErbB3 can form dimers and activate signaling pathways including MAPK, PI3K/Akt and PLCγ to promote tumor development[1][2][3][4].

Species

Rat

Source

HEK293

Tag

C-hFc

Accession

G3V6N1 (S20-H641)

Gene ID
Molecular Construction
N-term
HER3 (S20-H641)
Accession # G3V6N1
hFc
C-term
Protein Length

Partial

Synonyms
Receptor tyrosine-protein kinase erbB-3; ERBB3; HER3
AA Sequence

SEMGNSQAVCPGTLNGLSVTGDADNQYQTLYKLYEKCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSVLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLKFTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRVRGAEIVVKNNGANCPPCHEVCKGRCWGPGPDDCQILTKTICAPQCNGRCFGPNPNQCCHDECAGGCSGPQDTDCFACRRFNDSGACVPRCPEPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTFCVRACPPDKMEVDKHGLKMCEPCGGLCPKACEGTGSGSRYQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRVYISANQQLCYHHSLNWTRLLRGPSEERLDIKYNRPLGECLAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSREGVCVTHCNFLQGEPREFVHEAQCFSCHPECLPMEGTSTCNGSGSDACARCAHFRDGPHCVNSCPHGILGAKGPIYKYPDAQNECRPCHENCTQGCNGPELQDCLGQAEVLMSKPH

Predicted Molecular Mass
95.5 kDa
Molecular Weight

Approximately 115 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 80%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

HER3 Protein, Rat (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HER3 Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P74892
Quantity:
MCE Japan Authorized Agent: