HLTF Protein, Human (His)

HLTF protein has helicase and E3 ubiquitin ligase activities and has intrinsic ATP-dependent nucleosome remodeling ability. It is critical for the transcriptional regulation of specific promoters such as SERPINE1, HIV-1 and SV40. HLTF Protein, Human (His) is the recombinant human-derived HLTF protein, expressed by E. coli , with N-6*His labeled tag.

HLTF Protein exhibits both helicase and E3 ubiquitin ligase activities. With intrinsic ATP-dependent nucleosome-remodeling capabilities, it may be essential for the transcriptional modulation of specific target promoters such as SERPINE1, HIV-1, and SV40. Furthermore, HLTF plays a crucial role in error-free postreplication repair (PRR) of damaged DNA, contributing to genomic stability by acting as a ubiquitin ligase that catalyzes 'Lys-63'-linked polyubiquitination of chromatin-bound PCNA. These functions highlight its significance in maintaining the integrity of genomic processes and regulatory mechanisms.

Human

E. coli

N-6*His

Q14527 (V58-A174)

6596

Partial

VLFGSLRGHVVGLRYYTGVVNNNEMVALQRDPNNPYDKNAIKVNNVNGNQVGHLKKELAGALAYIMDNKLAQIEGVVPFGANNAFTMPLHMTFWGKEENRKAVSDQLKKHGFKLGPA

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.