1. Recombinant Proteins
  2. Enzymes & Regulators Ubiquitin Related Proteins
  3. Transferases (EC 2) Ubiquitin Enzymes
  4. E3 Ligases
  5. HLTF Protein, Human (His)

HLTF protein has helicase and E3 ubiquitin ligase activities and has intrinsic ATP-dependent nucleosome remodeling ability. It is critical for the transcriptional regulation of specific promoters such as SERPINE1, HIV-1 and SV40. HLTF Protein, Human (His) is the recombinant human-derived HLTF protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HLTF protein has helicase and E3 ubiquitin ligase activities and has intrinsic ATP-dependent nucleosome remodeling ability. It is critical for the transcriptional regulation of specific promoters such as SERPINE1, HIV-1 and SV40. HLTF Protein, Human (His) is the recombinant human-derived HLTF protein, expressed by E. coli , with N-6*His labeled tag.

Background

HLTF Protein exhibits both helicase and E3 ubiquitin ligase activities. With intrinsic ATP-dependent nucleosome-remodeling capabilities, it may be essential for the transcriptional modulation of specific target promoters such as SERPINE1, HIV-1, and SV40. Furthermore, HLTF plays a crucial role in error-free postreplication repair (PRR) of damaged DNA, contributing to genomic stability by acting as a ubiquitin ligase that catalyzes 'Lys-63'-linked polyubiquitination of chromatin-bound PCNA. These functions highlight its significance in maintaining the integrity of genomic processes and regulatory mechanisms.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q14527 (V58-A174)

Gene ID

6596

Molecular Construction
N-term
6*His
HLTF (V58-A174)
Accession # Q14527
C-term
Protein Length

Partial

Synonyms
HLTF; Helicase-like transcription factor; DNA-binding protein/plasminogen activator inhibitor 1 regulator; HIP116; RING finger protein 80; RING-type E3 ubiquitin transferase HLTF; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3; Sucrose nonfermenting protein 2-like 3
AA Sequence

VLFGSLRGHVVGLRYYTGVVNNNEMVALQRDPNNPYDKNAIKVNNVNGNQVGHLKKELAGALAYIMDNKLAQIEGVVPFGANNAFTMPLHMTFWGKEENRKAVSDQLKKHGFKLGPA

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

HLTF Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HLTF Protein, Human (His)
Cat. No.:
HY-P701529
Quantity:
MCE Japan Authorized Agent: