HLTF Protein, Human (His)
HLTF protein has helicase and E3 ubiquitin ligase activities and has intrinsic ATP-dependent nucleosome remodeling ability. It is critical for the transcriptional regulation of specific promoters such as SERPINE1, HIV-1 and SV40. HLTF Protein, Human (His) is the recombinant human-derived HLTF protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
HLTF protein has helicase and E3 ubiquitin ligase activities and has intrinsic ATP-dependent nucleosome remodeling ability. It is critical for the transcriptional regulation of specific promoters such as SERPINE1, HIV-1 and SV40. HLTF Protein, Human (His) is the recombinant human-derived HLTF protein, expressed by E. coli , with N-6*His labeled tag.
HLTF Protein exhibits both helicase and E3 ubiquitin ligase activities. With intrinsic ATP-dependent nucleosome-remodeling capabilities, it may be essential for the transcriptional modulation of specific target promoters such as SERPINE1, HIV-1, and SV40. Furthermore, HLTF plays a crucial role in error-free postreplication repair (PRR) of damaged DNA, contributing to genomic stability by acting as a ubiquitin ligase that catalyzes 'Lys-63'-linked polyubiquitination of chromatin-bound PCNA. These functions highlight its significance in maintaining the integrity of genomic processes and regulatory mechanisms.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q14527 (V58-A174)
-
Gene ID6596
-
Molecular Construction
-
N-term
-
6*His
-
HLTF (V58-A174)
Accession # Q14527 -
C-term
-
-
Protein Length
Partial
-
Synonyms
HLTF; SWI/SNF Related, Matrix Associated, Actin Dependent Regulator Of Chromatin, Subfamily A, Member 3; Prev. SMARCA3; RING Finger Protein 80; Prev. SNF2L3; HIP116; HIP116A; ZBU1; RNF80; DNA-Binding Protein/Plasminogen Activator Inhibitor-1 Regulator; SW
-
AA Sequence
VLFGSLRGHVVGLRYYTGVVNNNEMVALQRDPNNPYDKNAIKVNNVNGNQVGHLKKELAGALAYIMDNKLAQIEGVVPFGANNAFTMPLHMTFWGKEENRKAVSDQLKKHGFKLGPA
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
