Copy Link Print Information

HO-1 Protein, Human

3 Cited Publications
Customer Review

Based on 3 publication(s) in Google Scholar

HO-1 Protein, an enzyme, plays a critical role in cellular defense against oxidative stress and inflammation. Dysregulation of HO-1 Protein has been implicated in several diseases, including cardiovascular disorders and neuroinflammatory conditions. Targeting HO-1 Protein may offer potential therapeutic interventions by enhancing antioxidant defenses, reducing inflammation, and potentially treating these diseases. HO-1 Protein, Human is the recombinant human-derived HO-1 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for HO-1 Protein, Human
  • HO-1 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

HO-1 Protein, an enzyme, plays a critical role in cellular defense against oxidative stress and inflammation. Dysregulation of HO-1 Protein has been implicated in several diseases, including cardiovascular disorders and neuroinflammatory conditions. Targeting HO-1 Protein may offer potential therapeutic interventions by enhancing antioxidant defenses, reducing inflammation, and potentially treating these diseases. HO-1 Protein, Human is the recombinant human-derived HO-1 protein, expressed by E. coli , with tag free.

Background

The HO-1 protein serves as a catalyst for the oxidative cleavage of heme at the alpha-methene bridge carbon, resulting in the release of carbon monoxide (CO) and the generation of biliverdin IXalpha, while concurrently releasing the central heme iron chelate as ferrous iron. This process has been extensively documented in various publications. Moreover, HO-1 protein plays a crucial role in safeguarding against programmed cell death by catabolizing free heme, thereby preventing its ability to sensitize cells and induce apoptosis. Numerous studies have affirmed the cytoprotective effect of HO-1 protein. Additionally, in the context of microbial infection, it has been observed that during SARS-CoV-2 infection, HO-1 protein promotes SARS-CoV-2 ORF3A-mediated autophagy, although it is not deemed necessary for the induction of reticulophagy by ORF3A.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P09601 (M1-T261)

  • Gene ID
    3162  [NCBI]
  • Molecular Construction
    • N-term
    • HO-1 (M1-T261)
      Accession # P09601
    • C-term
  • Protein Length

    Cytoplasmic Domain

  • Synonyms

    HMOX1; Heme Oxygenase; Heme Oxygenase 1; HMOX1D; HO-1; HSP32; BK286B10; HO1; Heme Oxygenase (Decycling) 1; HO; Heat Shock Protein, 32-KD

  • AA Sequence

    MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNT

  • Predicted Molecular Mass

    29.8 kDa

  • Molecular Weight

    Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 1 mM EDTA, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • HO-1 Protein, Human Product Image
    1/16
  • Experimental Validation Results for HO-1 Protein, Human
  • HO-1 Protein, Human Product Image