ICOS Protein, Human (Biotinylated, C136S, C137S, HEK293, His-Avi )
ICOS proteins enhance T cell responses to foreign antigens, promote proliferation, lymphokine secretion, upregulation of cell-cell interaction molecules, and help B cells secrete antibodies. ICOS Protein, Human (Biotinylated, C136S, C137S, HEK293, His-Avi ) is the recombinant human-derived ICOS protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ICOS proteins enhance T cell responses to foreign antigens, promote proliferation, lymphokine secretion, upregulation of cell-cell interaction molecules, and help B cells secrete antibodies. ICOS Protein, Human (Biotinylated, C136S, C137S, HEK293, His-Avi ) is the recombinant human-derived ICOS protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
ICOS protein significantly enhances fundamental T-cell responses to foreign antigens, encompassing key activities such as cellular proliferation, lymphokine secretion, up-regulation of cell-cell interaction molecules, and effective facilitation of antibody secretion by B-cells. It proves essential for the efficient interplay between T and B-cells, crucial for normal antibody responses to T-cell-dependent antigens. Despite not influencing the production of interleukin-2, ICOS protein superinduces the synthesis of interleukin-10 and prevents the apoptosis of pre-activated T-cells. Moreover, ICOS plays a critical role in CD40-mediated class switching of immunoglobulin isotypes, demonstrating its multifaceted role in orchestrating immune responses. The protein forms homodimers linked by disulfide bonds, further contributing to its functional characteristics.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
Q9Y6W8-1 (E21-F141, C136S, C137S)
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
ICOS; CD278; Inducible T Cell Costimulator; Inducible T-Cell Co-Stimulator; Activation-Inducible Lymphocyte Immunomediatory Molecule; Inducible Costimulator; Inducible T-Cell Costimulator; CD278 Antigen; AILIM; CVID1
-
AA Sequence
EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLSSQLKF
-
Predicted Molecular Mass
17.4 kDa
-
Molecular Weight
Approximately 25-32 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
