ICOS Protein, Mouse (C137S, C138S, HEK293, His)

ICOS proteins optimize T cell responses to foreign antigens, promoting proliferation, lymphokine secretion, upregulation of cell-cell interaction molecules, and efficient B cell antibody secretion. ICOS is essential for efficient communication of T cells and B cells and for normal antibody responses to T cell-dependent antigens. ICOS Protein, Mouse (C137S, C138S, HEK293, His) is the recombinant mouse-derived ICOS protein, expressed by HEK293 , with C-His labeled tag and C137S, C138S mutation.

The ICOS protein enhances all fundamental T-cell responses to foreign antigens, including proliferation, secretion of lymphokines, up-regulation of cell-cell interaction molecules, and providing effective help for antibody secretion by B-cells. It is essential for facilitating efficient communication between T and B-cells and for normal antibody responses to T-cell dependent antigens. Although it does not increase the production of interleukin-2, it superinduces the synthesis of interleukin-10. Additionally, it prevents apoptosis of pre-activated T-cells and plays a critical role in CD40-mediated class switching of immunoglobulin isotypes. ICOS exists as a homodimer, connected by disulfide bonds.

Mouse

HEK293

C-8*His

Q9WVS0 (E21-L144, C137S, C138S)

54167  [NCBI]

Extracellular Domain

EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLSSQLKLWL

Approximately 27-38 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.