IFN-alpha 2/IFNA2 Protein, Mouse (His)
Based on 1 Customer Validation
IFN-alpha 2/IFNA2 Protein, synthesized by macrophages, exhibits potent antiviral activities. Its interaction with IFNAR2 plays a pivotal role in signaling processes, contributing to the intricate network of antiviral defense mechanisms. IFN-alpha 2/IFNA2 Protein, Mouse (His) is the recombinant mouse-derived IFN-alpha 2/IFNA2 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IFN-alpha 2/IFNA2 Protein, synthesized by macrophages, exhibits potent antiviral activities. Its interaction with IFNAR2 plays a pivotal role in signaling processes, contributing to the intricate network of antiviral defense mechanisms. IFN-alpha 2/IFNA2 Protein, Mouse (His) is the recombinant mouse-derived IFN-alpha 2/IFNA2 protein, expressed by E. coli , with N-6*His labeled tag.
Background
IFN-alpha 2/IFNA2, synthesized primarily by macrophages, possesses potent antiviral activities. Through its interaction with IFNAR2, it engages in crucial signaling processes, contributing to the intricate network of antiviral defense mechanisms.
Verified Bioactivity
Measured in a cytotoxicity assay using TF-1 human erythroleukemic cells. The ED50 this effect is 0.7778 ng/mL, corresponding to a specific activity is 1.286 × 106 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
P01573 (C24-E190)
-
Molecular Construction
-
N-term
-
6*His
-
IFNA2 (C24-E190)
Accession # P01573 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IFNA2; IFN-Alpha-2; Interferon Alpha 2; IFNA2B; IFN-AlphaA; LeIF A; IFNA; Interferon Alpha 2a; Alpha-2a Interferon; Interferon Alpha-A; Interferon Alpha 2b; Interferon 1AB4; Interferon Alpha A; IFNA2C; Interferon Alpha-2; IFNA2A
-
AA Sequence
CDLPHTYNLRNKRALKVLAQMRRLPFLSCLKDRQDFGFPLEKVDNQQIQKAQAIPVLRDLTQQTLNLFTSKASSAAWNATLLDSFCNDLHQQLNDLQTCLMQQVGVQEPPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLPRLSEEKE
-
Predicted Molecular Mass
19.3 kDa
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)