IFN-beta Protein, Rhesus Macaque (HEK293, Fc, Solution)

IFN-beta Protein, Rhesus Macaque (HEK293, Fc, Solution) is the recombinant rhesus macaque-derived IFN-beta protein, expressed by HEK293, with C-mFc tag.

IFN-beta Protein, a type I interferon cytokine, assumes a pivotal role in the innate immune response to infections, tumors, and various inflammatory stimuli. Its signaling involves binding to the high-affinity receptor IFNAR2 and the low-affinity receptor IFNAR1, forming a heterodimeric complex and activating the canonical Jak-STAT signaling pathway. This activation results in the transcriptional modulation of interferon-regulated genes, encompassing antiviral proteins, regulators of cell proliferation and differentiation, and immunoregulatory proteins. While predominantly signaling through the IFNAR1-IFNAR2 heterodimeric receptor, IFN-beta can also function with IFNAR1 alone, operating independently of Jak-STAT pathways. IFN-beta elicits diverse responses, including antiviral and antibacterial activities, and influences B-cell development, myelopoiesis, and lipopolysaccharide (LPS)-inducible production of tumor necrosis factor. Beyond its immune functions, IFN-beta plays a crucial role in neuronal homeostasis by regulating dopamine turnover and protecting dopaminergic neurons, promoting neuronal autophagy, and facilitating alpha-synuclein clearance, thereby preventing dopaminergic neuron loss. Notably, IFN-beta demonstrates greater potency than interferon-alpha (IFN-alpha) in inducing apoptotic and antiproliferative pathways crucial for controlling tumor cell growth. It functions as a monomer in these regulatory processes.

Measured in antiviral assay using WISH human amnion cells infected with vesicular stomatitisvirus (VSV). The ED₅₀ for this effect is 0.1-0.5 ng/mL.

Rhesus Macaque

HEK293

C-mFc

EHH24077.1 (M22-N187)

/

Full Length of Mature Protein

MSYNLLGFLQRSSSFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQPQQFQKEDAALTIYEMLQNIFAIFRQDLSSTGWNETIVENLLANVYHQIDHLKTILEEKLEKEDFTRGKFVSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFFFINKLTGYLRN

Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 85%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.