IFN-beta Protein, Rhesus Macaque (HEK293, Fc, Solution)
Based on 1 Customer Validation
IFN-beta Protein, Rhesus Macaque (HEK293, Fc, Solution) is the recombinant rhesus macaque-derived IFN-beta protein, expressed by HEK293, with C-mFc tag.
- Species: Rhesus Macaque
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
IFN-beta Protein, Rhesus Macaque (HEK293, Fc, Solution) is the recombinant rhesus macaque-derived IFN-beta protein, expressed by HEK293, with C-mFc tag.
Background
IFN-beta Protein, a type I interferon cytokine, assumes a pivotal role in the innate immune response to infections, tumors, and various inflammatory stimuli. Its signaling involves binding to the high-affinity receptor IFNAR2 and the low-affinity receptor IFNAR1, forming a heterodimeric complex and activating the canonical Jak-STAT signaling pathway. This activation results in the transcriptional modulation of interferon-regulated genes, encompassing antiviral proteins, regulators of cell proliferation and differentiation, and immunoregulatory proteins. While predominantly signaling through the IFNAR1-IFNAR2 heterodimeric receptor, IFN-beta can also function with IFNAR1 alone, operating independently of Jak-STAT pathways. IFN-beta elicits diverse responses, including antiviral and antibacterial activities, and influences B-cell development, myelopoiesis, and lipopolysaccharide (LPS)-inducible production of tumor necrosis factor. Beyond its immune functions, IFN-beta plays a crucial role in neuronal homeostasis by regulating dopamine turnover and protecting dopaminergic neurons, promoting neuronal autophagy, and facilitating alpha-synuclein clearance, thereby preventing dopaminergic neuron loss. Notably, IFN-beta demonstrates greater potency than interferon-alpha (IFN-alpha) in inducing apoptotic and antiproliferative pathways crucial for controlling tumor cell growth. It functions as a monomer in these regulatory processes.
Verified Bioactivity
Measured in antiviral assay using WISH human amnion cells infected with vesicular stomatitisvirus (VSV). The ED50 for this effect is 0.1-0.5 ng/mL.
Technical Parameters
-
Species Rhesus Macaque
-
Source HEK293
-
Tag C-mFc
-
Accession
EHH24077.1 (M22-N187)
-
Gene ID/
-
Molecular Construction
-
N-term
-
(M22-N187)
Accession # EHH24077.1 -
mFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IFNB1; IFF; Prev. IFNB; Fibroblast Interferon; IFB; IFN-Beta; Interferon Beta; Interferon-Beta; Interferon Beta 1; Interferon, Beta 1, Fibroblast
-
AA Sequence
MSYNLLGFLQRSSSFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQPQQFQKEDAALTIYEMLQNIFAIFRQDLSSTGWNETIVENLLANVYHQIDHLKTILEEKLEKEDFTRGKFVSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFFFINKLTGYLRN
-
Predicted Molecular Mass
46.4 KDa
-
Molecular Weight
Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)