Copy Link Print Information

IGF-I/IGF-1 Protein, Human (G49-A118)

6 Cited Publications
Customer Review

Based on 6 publication(s) in Google Scholar

The LR3 IGF-I/IGF-1 protein is similar to insulin and has potent growth-promoting activity that exceeds the efficacy of insulin. As a potential physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts even at significantly lower concentrations than insulin. IGF-I/IGF-1 Protein, Human (G49-A118) is the recombinant human-derived IGF-I/IGF-1 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (G49-A118)
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (G49-A118)
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (G49-A118)
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (G49-A118)
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (G49-A118)
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (G49-A118)
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (G49-A118)
  • IGF-I/IGF-1 Protein, Human (G49-A118) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The LR3 IGF-I/IGF-1 protein is similar to insulin and has potent growth-promoting activity that exceeds the efficacy of insulin. As a potential physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts even at significantly lower concentrations than insulin. IGF-I/IGF-1 Protein, Human (G49-A118) is the recombinant human-derived IGF-I/IGF-1 protein, expressed by E. coli , with tag free.

Background

The LR3 IGF-I/IGF-1 protein, structurally and functionally akin to insulin, boasts significantly heightened growth-promoting activity compared to its counterpart. Positioned as a potential physiological regulator, LR3 IGF-I may govern [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts, demonstrating effective stimulation of glucose transport in bone-derived osteoblastic (PyMS) cells even at markedly lower concentrations than insulin. Its multifaceted roles extend to potential involvement in synapse maturation and the Ca(2+)-dependent exocytosis essential for sensory perception of smell in the olfactory bulb. Operating as a ligand for IGF1R, LR3 IGF-I binds to the alpha subunit, initiating the activation of intrinsic tyrosine kinase activity, autophosphorylating tyrosine residues in the beta subunit. This activation triggers a cascade of downstream signaling events leading to the activation of the PI3K-AKT/PKB and Ras-MAPK pathways. Further, LR3 IGF-I forms crucial ternary complexes with integrins (ITGAV:ITGB3 and ITGA6:ITGB4) and IGFR1, essential for comprehensive IGF1 signaling, influencing the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2, and AKT1. It also exhibits diverse molecular interactions, including with SH2D3C isoform 2.

Verified Bioactivity

Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED50 for this effect is 1.706 ng/mL, corresponding to a specific activity is 5.86×105 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a serum-free cell proliferation assay using MCF‑7 human breast cancer cells. The ED50 for this effect is 1.706 ng/mL, corresponding to a specific activity is 5.86×105 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P05019-1 (G49-A118)

  • Gene ID
    3479  [NCBI]
  • Molecular Construction
    • N-term
    • IGF1 (G49-A118)
      Accession # P05019-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    IGF1; Somatomedin-C; Insulin Like Growth Factor 1; IGF1A; IGF-I; MGF; Insulin-Like Growth Factor 1; Insulin-Like Growth Factor IB; Insulin-Like Growth Factor I; Insulin-Like Growth Factor-I; IGFI; Alternative Protein IGF1; IGF; Somatomedin C; Insulin-Like

  • AA Sequence

    GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

  • Predicted Molecular Mass

    7.6 kDa

  • Molecular Weight

    Approximately 8-12 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM NaAc-HAC, pH 4.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 50 mM HAc. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a serum-free cell proliferation assay using MCF‑7 human breast cancer cells. The ED50 for this effect is 1.706 ng/mL, corresponding to a specific activity is 5.86×105 units/mg.

  • 1/16

    IGF-I/IGF-1 Protein, Human (G49-A118) purchased from MedChemExpress. Usage Cited in: Eur J Pharm Sci. 2024 Feb 1:193:106687. [Abstract]

    Customer Validation
     Scratch assays and cell-migration quantification were performed in T-BHP-injured 3T3 cells treated with IGF-1 (100 ng/mL; 24 h) or IGF-PLGA containing an equivalent IGF-1 concentration. IGF-1 and IGF-PLGA enhanced cell migration, with the strongest migration observed in the IGF-PLGA group.

  • 1/16

    IGF-I/IGF-1 Protein, Human (G49-A118) purchased from MedChemExpress. Usage Cited in: Eur J Pharm Sci. 2024 Feb 1:193:106687. [Abstract]

    Customer Validation
     Representative tubular structures and tube numbers were assessed in T-BHP-injured HUVECs treated with IGF-1 (100 ng/mL; 8 h) or IGF-PLGA containing an equivalent IGF-1 concentration. IGF-1 and IGF-PLGA enhanced HUVEC tube formation, with the most prominent effect observed in the IGF-PLGA group.

  • 1/16

    IGF-I/IGF-1 Protein, Human (G49-A118) purchased from MedChemExpress. Usage Cited in: J Cancer. 2024 Jan 1;15(4):1124-1137. [Abstract]

    Customer Validation
     The difference in cell migration distance under the action of IGF-1 (100 ng/mL; 24 h) was detected by the scratch test. IGF-1 enhanced cell invasion abilities.

  • 1/16

    IGF-I/IGF-1 Protein, Human (G49-A118) purchased from MedChemExpress. Usage Cited in: Bioengineered. 2021 Dec;12(2):11909-11921. [Abstract]

    Customer Validation
     Cell proliferation was assessed by CCK-8 in si-ITGA11 MKN45 cells treated with IGF-1 (50 ng/mL; 24-96 h). IGF-1 intervention facilitated cell proliferation versus the Si-ITGA11 group.

  • 1/16

    IGF-I/IGF-1 Protein, Human (G49-A118) purchased from MedChemExpress. Usage Cited in: Bioengineered. 2021 Dec;12(2):11909-11921. [Abstract]

    Customer Validation
     Transwell assays were used to evaluate migration and invasion in si-ITGA11 MKN45 cells treated with IGF-1 (50 ng/mL; 24 h). IGF-1 intervention strengthened cell migration and invasion versus the Si-ITGA11 group.

  • IGF-I/IGF-1 Protein, Human (G49-A118) Product Image
    1/16
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (G49-A118)
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (G49-A118)
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (G49-A118)
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (G49-A118)
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (G49-A118)
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (G49-A118)
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (G49-A118)
  • IGF-I/IGF-1 Protein, Human (G49-A118) Product Image

  • IGF-I/IGF-1 Protein, Human (G49-A118) purchased from MedChemExpress. Usage Cited in: Eur J Pharm Sci. 2024 Feb 1:193:106687. [Abstract]

    Scratch assays and cell-migration quantification were performed in T-BHP-injured 3T3 cells treated with IGF-1 (100 ng/mL; 24 h) or IGF-PLGA containing an equivalent IGF-1 concentration. IGF-1 and IGF-PLGA enhanced cell migration, with the strongest migration observed in the IGF-PLGA group.

  • IGF-I/IGF-1 Protein, Human (G49-A118) purchased from MedChemExpress. Usage Cited in: Eur J Pharm Sci. 2024 Feb 1:193:106687. [Abstract]

    Representative tubular structures and tube numbers were assessed in T-BHP-injured HUVECs treated with IGF-1 (100 ng/mL; 8 h) or IGF-PLGA containing an equivalent IGF-1 concentration. IGF-1 and IGF-PLGA enhanced HUVEC tube formation, with the most prominent effect observed in the IGF-PLGA group.

  • IGF-I/IGF-1 Protein, Human (G49-A118) purchased from MedChemExpress. Usage Cited in: J Cancer. 2024 Jan 1;15(4):1124-1137. [Abstract]

    The difference in cell migration distance under the action of IGF-1 (100 ng/mL; 24 h) was detected by the scratch test. IGF-1 enhanced cell invasion abilities.

  • IGF-I/IGF-1 Protein, Human (G49-A118) purchased from MedChemExpress. Usage Cited in: Bioengineered. 2021 Dec;12(2):11909-11921. [Abstract]

    Cell proliferation was assessed by CCK-8 in si-ITGA11 MKN45 cells treated with IGF-1 (50 ng/mL; 24-96 h). IGF-1 intervention facilitated cell proliferation versus the Si-ITGA11 group.

  • IGF-I/IGF-1 Protein, Human (G49-A118) purchased from MedChemExpress. Usage Cited in: Bioengineered. 2021 Dec;12(2):11909-11921. [Abstract]

    Transwell assays were used to evaluate migration and invasion in si-ITGA11 MKN45 cells treated with IGF-1 (50 ng/mL; 24 h). IGF-1 intervention strengthened cell migration and invasion versus the Si-ITGA11 group.