IGF-I/IGF-1 Protein, Human (P. pastoris, N-His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The LR3 IGF-I/IGF-1 protein is similar to insulin and has potent growth-promoting activity that exceeds the efficacy of insulin. As a potential physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts even at significantly lower concentrations than insulin. IGF-I/IGF-1 Protein, Human (P. pastoris, N-His) is the recombinant human-derived IGF-I/IGF-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The LR3 IGF-I/IGF-1 protein is similar to insulin and has potent growth-promoting activity that exceeds the efficacy of insulin. As a potential physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts even at significantly lower concentrations than insulin. IGF-I/IGF-1 Protein, Human (P. pastoris, N-His) is the recombinant human-derived IGF-I/IGF-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

The LR3 IGF-I/IGF-1 protein, structurally and functionally akin to insulin, boasts significantly heightened growth-promoting activity compared to its counterpart. Positioned as a potential physiological regulator, LR3 IGF-I may govern [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts, demonstrating effective stimulation of glucose transport in bone-derived osteoblastic (PyMS) cells even at markedly lower concentrations than insulin. Its multifaceted roles extend to potential involvement in synapse maturation and the Ca(2+)-dependent exocytosis essential for sensory perception of smell in the olfactory bulb. Operating as a ligand for IGF1R, LR3 IGF-I binds to the alpha subunit, initiating the activation of intrinsic tyrosine kinase activity, autophosphorylating tyrosine residues in the beta subunit. This activation triggers a cascade of downstream signaling events leading to the activation of the PI3K-AKT/PKB and Ras-MAPK pathways. Further, LR3 IGF-I forms crucial ternary complexes with integrins (ITGAV:ITGB3 and ITGA6:ITGB4) and IGFR1, essential for comprehensive IGF1 signaling, influencing the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2, and AKT1. It also exhibits diverse molecular interactions, including with SH2D3C isoform 2.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source P. pastoris
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • IGF1 (G49-A118)
      Accession # P05019-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    IGF1; Somatomedin-C; Insulin Like Growth Factor 1; IGF1A; IGF-I; MGF; Insulin-Like Growth Factor 1; Insulin-Like Growth Factor IB; Insulin-Like Growth Factor I; Insulin-Like Growth Factor-I; IGFI; Alternative Protein IGF1; IGF; Somatomedin C; Insulin-Like

  • AA Sequence

    GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

  • Predicted Molecular Mass

    9.7 kDa

  • Molecular Weight

    Approximately 9-10 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00