1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. IGF family Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. IGF-I R/CD221
  5. IGF-I/IGF-1 Protein, Mouse (HEK293, hFc)

The IGF-I/IGF-1 protein is structurally similar to insulin and has potent growth-promoting activity. As a physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts, exceeding the efficacy of insulin at lower concentrations. IGF-I/IGF-1 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived IGF-I/IGF-1 protein, expressed by HEK293, with N-hFc labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
100 μg Obtener un presupuesto 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Obtener un presupuesto  
Synthetic products have potential research and development risk.

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

The IGF-I/IGF-1 protein is structurally similar to insulin and has potent growth-promoting activity. As a physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts, exceeding the efficacy of insulin at lower concentrations. IGF-I/IGF-1 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived IGF-I/IGF-1 protein, expressed by HEK293, with N-hFc labeled tag.

Background

The IGF-I/IGF-1 protein, akin to insulin in structure and function, demonstrates significantly heightened growth-promoting activity. As a physiological regulator, it may govern [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts, effectively stimulating glucose transport in bone-derived osteoblastic (PyMS) cells at markedly lower concentrations than insulin. Additionally, IGF-I may contribute to synapse maturation and Ca(2+)-dependent exocytosis, crucial for sensory perception of smell in the olfactory bulb. Acting as a ligand for IGF1R, it binds to the alpha subunit, triggering the activation of intrinsic tyrosine kinase activity, which leads to autophosphorylation of tyrosine residues in the beta subunit. This initiation sets off a cascade of downstream signaling events, activating the PI3K-AKT/PKB and Ras-MAPK pathways. IGF-I also forms essential ternary complexes with integrins (ITGAV:ITGB3 and ITGA6:ITGB4) and IGFR1 for comprehensive IGF1 signaling, influencing the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2, and AKT1. Moreover, it interacts with SH2D3C isoform 2, highlighting its diverse molecular engagements.

Species

Mouse

Source

HEK293

Tag

N-hFc

Accession

P05017-1 (G49-A118)

Gene ID

16000

Molecular Construction
N-term
hFc
IGF-1 (G49-A118)
Accession # P05017-1
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
rMuIGF-1; IGF-IA; Somatamedin C; MGF; IGF-I
AA Sequence

GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA

Predicted Molecular Mass
34.1 kDa
Peso molecular

Approximately 35-45 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of 50 mM Tris, 100 mM Glycine, 25 mM Arginine, 150 mM NaCl, pH7.5 with trehalose as protectant.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

IGF-I/IGF-1 Protein, Mouse (HEK293, hFc)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
IGF-I/IGF-1 Protein, Mouse (HEK293, hFc)
Cat. No.:
HY-P704375
Cantidad:
MCE Japan Authorized Agent: