IGFLR1 Protein, Human (HEK293, Fc)
IGFLR1 protein, a probable cell membrane receptor, exhibits specific affinity for IGF-like family proteins IGFL1 and IGFL3, with higher binding affinity compared to others. This selective interaction profile suggests a key role for IGFLR1 in mediating cellular responses to these ligands, emphasizing its significance in the intricate network of cellular signaling pathways. IGFLR1 Protein, Human (HEK293, Fc) is the recombinant human-derived IGFLR1 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IGFLR1 protein, a probable cell membrane receptor, exhibits specific affinity for IGF-like family proteins IGFL1 and IGFL3, with higher binding affinity compared to others. This selective interaction profile suggests a key role for IGFLR1 in mediating cellular responses to these ligands, emphasizing its significance in the intricate network of cellular signaling pathways. IGFLR1 Protein, Human (HEK293, Fc) is the recombinant human-derived IGFLR1 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
The IGFLR1 protein emerges as a probable cell membrane receptor for the IGF-like family proteins, demonstrating a specific affinity for IGFL1 and IGFL3, with a higher binding affinity compared to other family members. This suggests a selective interaction profile between IGFLR1 and these ligands. Furthermore, IGFLR1 may also exhibit the capacity to bind IGFL2, further expanding its potential ligand repertoire. The distinctive binding preferences underscore the receptor's role in mediating cellular responses to IGF-like family proteins, highlighting its significance in the intricate network of cellular signaling pathways.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q9H665-1 (S23-P159)
-
Molecular Construction
-
N-term
-
IGFLR1 (S23-P159)
Accession # Q9H665-1 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
IGFLR1; IGF-Like Family Receptor 1; Prev. TMEM149; U2(RNU2) Small Nuclear RNA Auxiliary Factor 1-Like 4; Prev. U2AF1L4; U2 Small Nuclear RNA Auxiliary Factor 1-Like 4; Transmembrane Protein 149; IGF Like Family Receptor 1; FLJ22573
-
AA Sequence
SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWP
-
Predicted Molecular Mass
41.4 kDa
-
Molecular Weight
Approximately 59 kDa & 48 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
