IGSF11 Protein, Human (Biotinylated, Fc-Avi)
Based on 1 Customer Validation
IGSF11 Protein functions as a cell adhesion molecule, facilitating cellular adhesion through homophilic interactions. It also stimulates cell growth, suggesting its role in regulating cellular proliferation. IGSF11 Protein, Human (Biotinylated, Fc-Avi) is the recombinant human-derived IGSF11 protein, expressed by E. coli , with C-Avi, C-hFc labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IGSF11 Protein functions as a cell adhesion molecule, facilitating cellular adhesion through homophilic interactions. It also stimulates cell growth, suggesting its role in regulating cellular proliferation. IGSF11 Protein, Human (Biotinylated, Fc-Avi) is the recombinant human-derived IGSF11 protein, expressed by E. coli , with C-Avi, C-hFc labeled tag.
Background
IGSF11 Protein serves as a cell adhesion molecule by engaging in homophilic interactions, facilitating cellular adhesion processes. Additionally, it plays a role in stimulating cell growth, implying its involvement in the regulation of cellular proliferation.
Verified Bioactivity
Immobilized Biotinylated Human VSIG3 Fc-Avi at 5 μg/mL (100 μL/well) on Streptavidin precoated (0.5 μg/well) plate can bind Human B7-H5 mFc with a linear range of 0.039-0.625 μg/mL.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-Avi;C-hFc
-
Accession
Q5DX21-1 (L23-G241)
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
IGSF11; CXADRL1; Immunoglobulin Superfamily Member 11; BTIGSF; VSIG3; Brain And Testis-Specific Immunoglobin Superfamily Protein; BT-IgSF; V-Set And Immunoglobulin Domain Containing 3; Igsf13; Immunoglobulin Superfamily, Member 11; CT119; Alternative Protein IGSF11; Brain And Testis-Specific Immunoglobulin Superfamily Protein; CXADR Like 1; V-Set And Immunoglobulin Domain-Containing Protein 3; Bt-IGSF; Cancer/Testis Antigen 119; IgSF11; MGC35227
-
AA Sequence
LEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIG
-
Predicted Molecular Mass
51.5 kDa
-
Molecular Weight
Approximately 60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 100 mM Glycine, 25 mM Arginine, 150 mM NaCl, pH 7.5, 10% trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
/
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
