1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. Interleukin & Receptors Cytokine Receptors
  4. IL-17 Receptor
  5. IL-17RD
  6. IL-17RD Protein, Mouse (CHO)

Interleukin-17 receptor D (IL-17RD) also known as Sef (similar expression to fibroblast growth factor), is a type I transmembrane protein that can regulate several signaling pathways. Within the cell, IL-17RD expression has been localized mainly to the plasma membrane. IL-17RD is a feedback inhibitor of fibroblast growth factor (FGF) signaling. IL-17RD Protein, Mouse (CHO) is produced in CHO cells, and consists of 2713 amino acids (G29-R299).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Interleukin-17 receptor D (IL-17RD) also known as Sef (similar expression to fibroblast growth factor), is a type I transmembrane protein that can regulate several signaling pathways. Within the cell, IL-17RD expression has been localized mainly to the plasma membrane. IL-17RD is a feedback inhibitor of fibroblast growth factor (FGF) signaling[1]. IL-17RD Protein, Mouse (CHO) is produced in CHO cells, and consists of 2713 amino acids (G29-R299).

Background

IL-17RD is a type I transmembrane protein that is evolutionarily conserved among vertebrates and is encoded by a single locus on chromosome 3p14.3 in humans. Within the cell, IL-17RD expression has been localized mainly to the plasma membrane although its expression has also been observed in the Golgi apparatus and in early and recycling endosomes (perinuclear structures) in overexpression systems[1].
The amino acid sequence of human IL-17RC protein shares 87% homology with mouse IL-17C protein.
Structurally, human IL-17RD is encoded by a single locus on chromosome 3p14.3 in humans. The mRNA consists of 13 exons encoding a polypeptide product of 739 amino acids comprised of a 26-residue amino terminal signal peptide, followed by a 272 amino acid extracellular domain, a short transmembrane domain consisting of 20 amino acids, and a 420 amino acid intracellular domain. The extracellular domain of IL-17RD consisting of a signal peptide, an immunoglobulin-like domain and a fibronectin type III repeat. Physiologically, IL-17RD has been shown to exist in monomeric, dimeric as well as oligomeric forms, showing a preference for oligomerization. In its dimeric form, SEF exists as a homodimer as well as in heterodimeric forms with FGFR1 (through its extracellular, transmembrane and intracellular domain), FGFR2 (via its extracellular, transmembrane and intracellular), IL-17RA (predominantly through its SEFIR domain), TNFR2 (via its extracellular domain) TLR3 (partly through its SEFIR domain) and TLR4 (partly through its SEFIR domain) and with Epidermal Growth Factor Receptor (EGFR)[1][2].
IL-17RD is initially established as a negative regulator of FGF-induced Ras and MAPK signalling pathways during zebrafish and frog development. It is subsequently determined to regulate other receptor tyrosine kinase signaling cascades as well as several proinflammatory signaling pathways including Interleukin-17A (IL17A), Toll-like receptors (TLR) and Interleukin-1α (IL1α) in several vertebrate species including humans. In addition, in mammalian IL-17RD can inhibit ERK and PI3K pathways in response to a number of receptor tyrosine kinase ligands. IL-17RD is a negative regulator of both NF-κB and IRF signalling pathways initiated by Toll-like receptors (TLRs). The SEFIR domain of IL-17RD targets the TIR adaptors, MyD88, Mal, TRIF and TRAM, and strongly inhibits TLR-mediated activation of NF-κB with IL-17RD deficiency leading to increased NF-κB and IRF activation and upregulation of pro-inflammatory genes. IL-17RD might regulate the activation of the TGFβ/BMP pathway. Additionally, the IL-17RD isoform is also shown to associate with and promote Lys63 polyubiquitination of TAK1 in HEK293T cells. IL-17RD promotes apoptosis by activating both p38 MAPK and JNK pathways upon ultraviolet light exposure in an overexpression model. IL-17RD is involved in the regulation of cancer, neuroendocrine, inflammatory and immunomodulatory diseases[1][2].

In Vivo

In collagen-induced arthritis (CIA) induction in DBA/1 mice, female DBA/1J mice (6-7 weeks old), Recombinant human IL-17RD administered intraperitoneally (5 mg/kg) every other day seven times beginning on day 22 after the first immunization. IL-17RD accelerates CIA and the inflammatory response in vivo[3].

Biological Activity

Measured by its ability to inhibit bFGF-induced NIH3T3 cell proliferation. The ED50 this effect is 0.1396 μg/mL, corresponding to a specific activity is 7.163×103 units/mg in the presence of 0.1 ng/mL bFGF.

  • Measured by its ability to inhibit bFGF-induced NIH3T3 cell proliferation. The ED50 this effect is 0.1396 μg/mL, corresponding to a specific activity is 7.163×103 units/mg in the presence of 0.1 ng/mL bFGF.
Species

Mouse

Source

CHO

Tag

Tag Free

Accession

Q8JZL1-1 (G29-R299)

Gene ID
Molecular Construction
N-term
IL-17RD (G29-R299)
Accession # Q8JZL1-1
C-term
Protein Length

Partial

Synonyms
Interleukin-17 receptor D; IL-17 receptor D; IL-17RD; mSef; Il17rd; Sef
AA Sequence

GSGRARGADTCGWRGVGPASRNSGLHNITFRYDNCTTYLNPGGKHAIADAQNITISQYACHDQVAVTILWSPGALGIEFLKGFRVILEELKSEGRQCQQLILKDPKQLNSSFRRTGMESQPFLNMKFETDYFVKIVPFPSIKNESNYHPFFFRTRACDLLLQPDNLACKPFWKPRNLNISQHGSDMHVSFDHAPQNFGFRGFHVLYKLKHEGPFRRRTCRQDQNTETTSCLLQNVSPGDYIIELVDDSNTTRKAAQYVVKSVQSPWAGPIR

Molecular Weight

31-67 kDa

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE. The protein migrates as a 31-67 kDa band under reducing SDS-PAGE due to glycosylation.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg; determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-17RD Protein, Mouse (CHO)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-17RD Protein, Mouse (CHO)
Cat. No.:
HY-P72794
Quantity:
MCE Japan Authorized Agent: