IL-18BP Protein, Human (Biotinylated, HEK293, His-Avi)
Based on 1 Customer Validation
IL-18BP isoform A, a potent regulator, binds to IL-18, effectively inhibiting its activity. Serving as a suppressor, IL-18BP restrains early TH1 cytokine responses, playing a pivotal role in modulating immune reactions and maintaining cytokine balance. IL-18BP Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived IL-18BP protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-18BP isoform A, a potent regulator, binds to IL-18, effectively inhibiting its activity. Serving as a suppressor, IL-18BP restrains early TH1 cytokine responses, playing a pivotal role in modulating immune reactions and maintaining cytokine balance. IL-18BP Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived IL-18BP protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
IL-18 binding protein (IL-18BP), specifically isoform A, serves as a potent regulator by binding to IL-18 and effectively inhibiting its activity. Acting as a suppressor, IL-18BP functions to restrain the early TH1 cytokine response, highlighting its pivotal role in modulating immune reactions and maintaining cytokine balance.
Verified Bioactivity
Immobilized Human IL-18 at 2 μg/mL (100μL/Well) on the plate. Dose response curve for Biotinylated Human IL-18BP His with the EC50 of 6.1-21 ng/mL determined by ELISA.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
O95998-2 (T31-G194)
-
Molecular Construction
-
N-term
-
IL-18BP (T31-G194)
Accession # O95998-2 -
8*His-Avi
-
C-term
-
-
Protein Length
Full Length of Isoform-2
-
Conjugation
Biotin
-
Synonyms
IL18BP; MC51L-53L-54L Homolog Gene Product; Interleukin 18 Binding Protein; Tadekinig-Alfa; Interleukin-18-Binding Protein; IL-18BP; IL18BPa; FVH
-
AA Sequence
TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG
-
Predicted Molecular Mass
20.5 kDa
-
Molecular Weight
Approximately 33-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
