IL-18BP Protein, Human (Biotinylated, HEK293, His-Avi)

IL-18BP isoform A, a potent regulator, binds to IL-18, effectively inhibiting its activity. Serving as a suppressor, IL-18BP restrains early TH1 cytokine responses, playing a pivotal role in modulating immune reactions and maintaining cytokine balance. IL-18BP Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived IL-18BP protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

IL-18 binding protein (IL-18BP), specifically isoform A, serves as a potent regulator by binding to IL-18 and effectively inhibiting its activity. Acting as a suppressor, IL-18BP functions to restrain the early TH1 cytokine response, highlighting its pivotal role in modulating immune reactions and maintaining cytokine balance.

Immobilized Human IL-18 at 2 μg/mL (100μL/Well) on the plate. Dose response curve for Biotinylated Human IL-18BP His with the EC₅₀ of 6.1-21 ng/mL determined by ELISA.

Human

HEK293

C-Avi;C-8*His

O95998-2 (T31-G194)

10068  [NCBI]

Full Length of Isoform-2 Mature Protein

Biotin

TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG

Approximately 52-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.