IL-22 Protein, Human (His)
Based on 1 Customer Validation
Animal-derived-free IL-22 protein is a cytokine that regulates tissue responses during inflammation and contributes to epithelial cell regeneration to maintain barrier function and prevent tissue damage. IL-22 Protein, Human (His) is the recombinant human-derived IL-22 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Animal-derived-free IL-22 protein is a cytokine that regulates tissue responses during inflammation and contributes to epithelial cell regeneration to maintain barrier function and prevent tissue damage. IL-22 Protein, Human (His) is the recombinant human-derived IL-22 protein, expressed by E. coli , with tag free.
IL-22 Protein assumes a pivotal role in modulating tissue responses during inflammation, demonstrating a crucial involvement in the regeneration of epithelial cells to preserve barrier function following injury and forestall further tissue damage. Unlike most cytokines, IL-22 exerts no influence on immune cells, relying on a heterodimeric receptor comprising the specific IL22RA1 receptor, found on non-immune cells in various organs, and the shared subunit IL10RB. The binding of IL-22 to IL22RA1 activates the tyrosine kinases JAK1 and TYK2, subsequently triggering STAT3 activation. This, in turn, promotes cell survival and proliferation through the STAT3, ERK1/2, and PI3K/AKT pathways, contributing to the phosphorylation of GSK3B at 'Ser-9' and CTTN. Additionally, IL-22 fosters epithelial cell spreading.
Measured by its ability to induce IL-10 secretion in COLO 205 human colorectal adenocarcinoma cells. The ED50 for this effect is 128.1 pg/mL. Corresponding to a specific activity is 7.81×106 U/mg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9GZX6 (A34-I179)
-
Molecular Construction
-
N-term
-
6*His
-
IL-22 (A34-I179)
Accession # Q9GZX6 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL22; TIFa; Interleukin 22; IL-10-Related T-Cell-Derived Inducible Factor; IL-TIF; Cytokine Zcyto18; ILTIF; Interleukin-22; IL-22; MGC79382; TIFIL-23; MGC79384; Zcyto18; IL-10-Related T-Cell-Derived-Inducible Factor; IL-D110; Interferon 2B1; IL-21; ZCYTO1
-
AA Sequence
APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
-
Predicted Molecular Mass
16.7 kDa
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Structure/Form
Monomer
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
