IL-24 Protein, Human (HEK293, Fc)
IL-24 protein, produced by T-cells, regulates immune responses, tissue homeostasis, defense, and oncogenesis. It induces type I interferon response in influenza infection, signaling through IL20RA/IL20RB or IL20RB/IL22RA1 receptor complexes to stimulate JAK1-STAT3 and MAPK pathways. IL-24 promotes secretion of IL8 and MMP1, maintains ER homeostasis, and serves as a quality control mechanism for the ubiquitin proteasome system. IL-24 Protein, Human (HEK293, Fc) is the recombinant human-derived IL-24 protein, expressed by HEK293 , with C-mFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-24 protein, produced by T-cells, regulates immune responses, tissue homeostasis, defense, and oncogenesis. It induces type I interferon response in influenza infection, signaling through IL20RA/IL20RB or IL20RB/IL22RA1 receptor complexes to stimulate JAK1-STAT3 and MAPK pathways. IL-24 promotes secretion of IL8 and MMP1, maintains ER homeostasis, and serves as a quality control mechanism for the ubiquitin proteasome system. IL-24 Protein, Human (HEK293, Fc) is the recombinant human-derived IL-24 protein, expressed by HEK293 , with C-mFc labeled tag.
Background
IL-24 protein, a multifunctional cytokine primarily produced by T-cells, orchestrates a regulatory role in immune responses, tissue homeostasis, host defense, and oncogenesis. Demonstrating antiviral functions, IL-24 induces the type I interferon response during influenza infection. The cytokine signals through two receptor complexes, IL20RA/IL20RB or IL20RB/IL22RA1, stimulating the JAK1-STAT3 and MAPK pathways, thereby promoting the secretion of pro-inflammatory mediators, including IL8 and MMP1. Intracellularly, IL-24 maintains endoplasmic reticulum homeostasis by constraining the eIF2alpha-CHOP pathway-mediated stress signal. Additionally, it acts as a quality control mechanism for the ubiquitin proteasome system, detecting proteasome dysfunction and activating PKR/EIF2AK2.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-mFc
-
Accession
Q13007-2 (Q53-L207)
-
Molecular Construction
-
N-term
-
IL-24 (Q53-L207)
Accession # Q13007-2 -
mFc
-
C-term
-
-
Protein Length
Full Length of Isoform-2
-
Synonyms
IL24; IL-4-Induced Secreted Protein; Prev. ST16; Mob-5; Interleukin-24; MDA7; IL10B; Melanoma Differentiation Association Protein 7; IL-24; Suppression Of Tumorigenicity 16 Protein; C49A; Melanocyte-Associated Mda-7; FISP; MDA-7; Suppression Of Tumorigeni
-
AA Sequence
QEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL
-
Predicted Molecular Mass
44.6 kDa
-
Molecular Weight
Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
