1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-24
  5. IL-24 Protein, Human (HEK293, Fc)

IL-24 protein, produced by T-cells, regulates immune responses, tissue homeostasis, defense, and oncogenesis. It induces type I interferon response in influenza infection, signaling through IL20RA/IL20RB or IL20RB/IL22RA1 receptor complexes to stimulate JAK1-STAT3 and MAPK pathways. IL-24 promotes secretion of IL8 and MMP1, maintains ER homeostasis, and serves as a quality control mechanism for the ubiquitin proteasome system. IL-24 Protein, Human (HEK293, Fc) is the recombinant human-derived IL-24 protein, expressed by HEK293 , with C-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-24 protein, produced by T-cells, regulates immune responses, tissue homeostasis, defense, and oncogenesis. It induces type I interferon response in influenza infection, signaling through IL20RA/IL20RB or IL20RB/IL22RA1 receptor complexes to stimulate JAK1-STAT3 and MAPK pathways. IL-24 promotes secretion of IL8 and MMP1, maintains ER homeostasis, and serves as a quality control mechanism for the ubiquitin proteasome system. IL-24 Protein, Human (HEK293, Fc) is the recombinant human-derived IL-24 protein, expressed by HEK293 , with C-mFc labeled tag.

Background

IL-24 protein, a multifunctional cytokine primarily produced by T-cells, orchestrates a regulatory role in immune responses, tissue homeostasis, host defense, and oncogenesis. Demonstrating antiviral functions, IL-24 induces the type I interferon response during influenza infection. The cytokine signals through two receptor complexes, IL20RA/IL20RB or IL20RB/IL22RA1, stimulating the JAK1-STAT3 and MAPK pathways, thereby promoting the secretion of pro-inflammatory mediators, including IL8 and MMP1. Intracellularly, IL-24 maintains endoplasmic reticulum homeostasis by constraining the eIF2alpha-CHOP pathway-mediated stress signal. Additionally, it acts as a quality control mechanism for the ubiquitin proteasome system, detecting proteasome dysfunction and activating PKR/EIF2AK2.

Species

Human

Source

HEK293

Tag

C-mFc

Accession

Q13007-2 (Q53-L207)

Gene ID
Molecular Construction
N-term
IL-24 (Q53-L207)
Accession # Q13007-2
mFc
C-term
Protein Length

Full Length of Isoform-2 Mature Protein

Synonyms
Interleukin-24; Melanoma differentiation-associated gene 7 protein; MDA-7; ST16
AA Sequence

QEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL

Predicted Molecular Mass
44.6 kDa
Molecular Weight

Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 80%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

IL-24 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-24 Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-24 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P77004
Quantity:
MCE Japan Authorized Agent: