1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins
  3. Interleukin & Receptors T Cell CD Proteins B Cell CD Proteins NK Cell CD Proteins Cytokine Receptors
  4. IL-2 Receptor IL-2R alpha/CD25
  5. IL-2R alpha/CD25 Protein, Canine (HEK293, His)

IL-2R alpha/CD25 Protein, Canine (HEK293, His)

Cat. No.: HY-P78636
Handling Instructions Technical Support

IL-2R alpha (CD25) is an essential component of high-affinity IL-2 receptors. IL-2R alpha enhances binding of IL-2 to its receptor complex so that regulates T cell growth and other lymphoid functions. IL-2R alpha/CD25 Protein, Canine (HEK293, His) is a recombinant canine IL-2R alpha protein with a His tag at the C-terminus and is expressed in HEK293 cells. It consists of 216 amino acids (D22-Q237).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-2R alpha (CD25) is an essential component of high-affinity IL-2 receptors. IL-2R alpha enhances binding of IL-2 to its receptor complex so that regulates T cell growth and other lymphoid functions[1][2]. IL-2R alpha/CD25 Protein, Canine (HEK293, His) is a recombinant canine IL-2R alpha protein with a His tag at the C-terminus and is expressed in HEK293 cells. It consists of 216 amino acids (D22-Q237).

Background

IL-2R alpha (CD25) is a type I membrane protein. IL-2R alpha is expressed in peripheral activated T and B cells, triple-negative thymocytes, and bone marrow pre-B cells. In high tumor regulatory T (Treg) cells, IL-2R alpha is highly expressed and is a potential target for Treg deletion. The expression of IL-2R alpha is undetectable on resting T cells[1][2][3].
The sequence of amino acids in IL-2R alpha from canine is very different with other animals like human, rat and mouse (less than 85% similarity).
IL-2R alpha is an essential component of high-affinity IL-2 receptors and has no signal-transducing activity per se. IL-2R alpha functions through enhancing binding of IL-2 to its receptor complex and acts as a positive feedback regulator. IL-2 is a principal growth factor for T lymphocytes and plays an important role in T cell immune response. IL-2R alpha transcription is regulated by three positive regulatory regions (PRRs): PRRI, PRRII and PRRIII. PRRIII is an IL-2 response element[1][2].
IL-2R alpha regulates T cell growth, augments lymphocyte activation and proliferation. IL-2R alpha is involved in preventing type 1 diabetes and cancers[1][2][4].

Biological Activity

Immobilized Canine IL-2 R alpha His at 5 μg/mL (100 μL/well) can bind Biotinylated Human IL-2 Fc-Avi with a linear range of 0.1-10 ng/mL.

Species

Canine

Source

HEK293

Tag

C-His

Accession

O62802 (D22-Q237)

Gene ID
Molecular Construction
N-term
IL-2Rα (D22-Q237)
Accession # O62802
His
C-term
Protein Length

Extracellular Domain

Synonyms
IL2RA; CD25; p55; IL2-RA; IL-2-RA
AA Sequence

DLCDDDPPNLKHATFKALTYKTGTVLNCDCERGFRRISSYMHCTGNSSHASWENKCRCKSVSPENRKGKVTTKPEEQKGENPTEMQSQTPPMDEVDLVGHCREPPPWEHENSKRIYHFVVGQTLHYQCMQGFTALHRGPAKSICKTIFGKTRWTQPPLKCISESQFPDDEELQASTDAPAGRDTSSPFITTSTPDFHKHTEVATTMESFIFTTEYQ

Molecular Weight

45-55 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4. Normally trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-2R alpha/CD25 Protein, Canine (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-2R alpha/CD25 Protein, Canine (HEK293, His)
Cat. No.:
HY-P78636
Quantity:
MCE Japan Authorized Agent: