IL-2R alpha/CD25 Protein, Canine (HEK293, His)
IL-2R alpha (CD25) is an essential component of high-affinity IL-2 receptors. IL-2R alpha enhances binding of IL-2 to its receptor complex so that regulates T cell growth and other lymphoid functions. IL-2R alpha/CD25 Protein, Canine (HEK293, His) is a recombinant canine IL-2R alpha protein with a His tag at the C-terminus and is expressed in HEK293 cells. It consists of 216 amino acids (D22-Q237).
- Species: Canine
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
IL-2R alpha (CD25) is an essential component of high-affinity IL-2 receptors. IL-2R alpha enhances binding of IL-2 to its receptor complex so that regulates T cell growth and other lymphoid functions[1][2]. IL-2R alpha/CD25 Protein, Canine (HEK293, His) is a recombinant canine IL-2R alpha protein with a His tag at the C-terminus and is expressed in HEK293 cells. It consists of 216 amino acids (D22-Q237).
Background
IL-2R alpha (CD25) is a type I membrane protein. IL-2R alpha is expressed in peripheral activated T and B cells, triple-negative thymocytes, and bone marrow pre-B cells. In high tumor regulatory T (Treg) cells, IL-2R alpha is highly expressed and is a potential target for Treg deletion. The expression of IL-2R alpha is undetectable on resting T cells[1][2][3].
The sequence of amino acids in IL-2R alpha from canine is very different with other animals like human, rat and mouse (less than 85% similarity).
IL-2R alpha is an essential component of high-affinity IL-2 receptors and has no signal-transducing activity per se. IL-2R alpha functions through enhancing binding of IL-2 to its receptor complex and acts as a positive feedback regulator. IL-2 is a principal growth factor for T lymphocytes and plays an important role in T cell immune response. IL-2R alpha transcription is regulated by three positive regulatory regions (PRRs): PRRI, PRRII and PRRIII. PRRIII is an IL-2 response element[1][2].
IL-2R alpha regulates T cell growth, augments lymphocyte activation and proliferation. IL-2R alpha is involved in preventing type 1 diabetes and cancers[1][2][4].
Technical Parameters
-
Species Canine
-
Source HEK293
-
Tag C-His
-
Accession
O62802 (D22-Q237)
-
Molecular Construction
-
N-term
-
IL-2Rα (D22-Q237)
Accession # O62802 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
IL2RA; TAC Antigen; Prev. IDDM10; Insulin-Dependent Diabetes Mellitus 10; Prev. IL2R; CD25 Antigen; Interleukin-2 Receptor Subunit Alpha; IL-2-RA; CD25; IL2-RA; Interleukin 2 Receptor, Alpha; IMD41; IL-2 Receptor Subunit Alpha; TCGFR; IL-2R Subunit Alpha;
-
AA Sequence
DLCDDDPPNLKHATFKALTYKTGTVLNCDCERGFRRISSYMHCTGNSSHASWENKCRCKSVSPENRKGKVTTKPEEQKGENPTEMQSQTPPMDEVDLVGHCREPPPWEHENSKRIYHFVVGQTLHYQCMQGFTALHRGPAKSICKTIFGKTRWTQPPLKCISESQFPDDEELQASTDAPAGRDTSSPFITTSTPDFHKHTEVATTMESFIFTTEYQ
-
Predicted Molecular Mass
26.4 kDa
-
Molecular Weight
Approximately 45-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
References
[1]. H.Asao. Interleukin-2. Reference Module in Biomedical Sciences. 2014. ISBN 9780128012383.
[2]. Kim HP, et al. The basis for IL-2-induced IL-2 receptor alpha chain gene regulation: importance of two widely separated IL-2 response elements. Immunity. 2001 Jul;15(1):159-72. [Content Brief]
[3]. Bell CJ, et al. Sustained in vivo signaling by long-lived IL-2 induces prolonged increases of regulatory T cells. J Autoimmun. 2015 Jan;56:66-80. [Content Brief]
[4]. Chistiakov DA, et al. The crucial role of IL-2/IL-2RA-mediated immune regulation in the pathogenesis of type 1 diabetes, an evidence coming from genetic and animal model studies. Immunol Lett. 2008 Jun 15;118(1):1-5. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
