IL-9 Protein, Human (CHO)
Based on 1 publication(s) in Google Scholar
IL-9 Protein, Human (CHO) is a CHO cell derived immunoregulatory cytokine produced by IL-2 activated Th2 lymphocytes.
- Species: Human
- Source: CHO
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-9 Protein, Human (CHO) is a CHO cell derived immunoregulatory cytokine produced by IL-2 activated Th2 lymphocytes.
Background
Interleukin 9 (IL-9) is cytokine produced by a subgroup of helper T cells, known as Th2 cells. IL-9 signals through its receptor IL-9R to induce cell proliferation and survival. Genetically, IL-9 has been identified as a gene associated with asthma.Human interleukin-9 (IL-9) was originally identified and cloned based on its stimulatory effect on proliferation of human myeloid cell line, M07e. IL-9 synergized with Steel factor, the ligand for the c-kit product, to stimulate M07e cell proliferation[1]
Verified Bioactivity
The ED50 is <1 ng/mL as measured by MO7e cells, corresponding to a specific activity of >1 × 106 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Int J Med Sci
Integrated analysis of FKBP1A/SLC3A2 axis in everolimus inducing ferroptosis of breast cancer and anti-proliferation of T lymphocyte. [Abstract]2023 Jun 26;20(8):1060-1078. PMID: 37484811
Technical Parameters
-
Species Human
-
Source CHO
-
Tag Tag Free
-
Accession
P15248 (Q19-I144)
-
Molecular Construction
-
N-term
-
IL-9 (Q19-I144)
Accession # P15248 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL9; Homolog Of Mouse T Cell And Mast Cell Growth Factor 40; Interleukin 9; P40 T-Cell And Mast Cell Growth Factor; IL-9; Interleukin-9; T-Cell Growth Factor P40; P40 Cytokine; HP40; Cytokine P40; P40
-
AA Sequence
QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
-
Molecular Weight
Approximately 25-40 kDa, based on SDS-PAGE under non reducing (N) conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)