Janus kinase 2/JAK2 Protein, Human (381a.a, His)
Based on 1 publication(s) in Google Scholar
Janus kinase 2/JAK2 Protein, Human is a recombinant human JAK2 expressed in E. coli with a His tag at the N-terminus. JAK2 is a non-receptor tyrosine kinase.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Janus kinase 2/JAK2 Protein, Human is a recombinant human JAK2 expressed in E. coli with a His tag at the N-terminus. JAK2 is a non-receptor tyrosine kinase[1][2].
Background
JAK2 is a member of the Janus kinase (JAKs) family of non-receptor protein tyrosine kinases, which includes JAK1-3 and TYK2. JAKs serve as the cytoplasmic signaling components of cytokine receptors and are activated through cytokine-mediated trans-phosphorylation, which leads to receptor phosphorylation and recruitment and phosphorylation of signal transducer and activator of transcription (STAT) proteins. JAKs are non-receptor protein tyrosine kinases that serve as the catalytic signaling components for a wide range of cytokine receptors, including the receptors for interleukins, interferons, growth hormone, erythropoietin, and leptin[1][2].
Verified Bioactivity
The kinase activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Nat Commun
2025 Sep 30;16(1):8684. PMID: 41028750
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
O60674-1 (K752-G1132)
-
Molecular Construction
-
N-term
-
6*His
-
JAK2 (K752-G1132)
Accession # O60674-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
JAK2; JAK-2; Janus Kinase 2; Janus Kinase 2 (A Protein Tyrosine Kinase); JTK10; Tyrosine-Protein Kinase; Tyrosine-Protein Kinase JAK2; Janus Kinase
-
AA Sequence
KPLSALDSQRKLQFYEDRHQLPAPKWAELANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
-
Predicted Molecular Mass
48.6 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
