KGF-2/FGF-10 Protein, Human (Biotinylated, His-Avi)

KGF-2/FGF-10 proteins coordinate embryonic development, regulate cell proliferation and differentiation, and are indispensable in branching morphogenesis. This multifunctional protein may aid in wound healing. KGF-2/FGF-10 Protein, Human (Biotinylated, His-Avi) is the recombinant human-derived KGF-2/FGF-10 protein, expressed by E. coli , with N-His, N-Avi labeled tag. The total length of KGF-2/FGF-10 Protein, Human (Biotinylated, His-Avi) is 171 a.a., with molecular weight of ~27 kDa.

KGF-2/FGF-10 Protein assumes a crucial role in orchestrating embryonic development, exerting regulatory control over essential processes such as cell proliferation and differentiation. Its significance extends to the intricate domain of normal branching morphogenesis, where KGF-2/FGF-10 is indispensable. This versatile protein may also contribute to wound healing processes. Through crucial interactions, it engages with FGFR1 and FGFR2, forming molecular complexes that underlie its multifaceted functions. Furthermore, KGF-2/FGF-10 interacts with FGFBP1, emphasizing its intricate network of associations in orchestrating cellular responses and developmental events.

Biotinylated Human FGF-10, His,Avitag immobilized on SA Chip can bind Human FGFR2 (IIIb), His Tag with an affinity constant of 1.0-10.0 μM as determined in a SPR assay.

Human

E. coli

N-His;N-Avi

O15520 (Q38-S208)

2255  [NCBI]

Full Length of Mature Protein

Biotin

QALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS

Approximately 27 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of PBS, 0.5 M Arginine, pH 7.4, 10% trehalose.

<0.1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.