KGF-2/FGF-10 Protein, Human (Biotinylated, His-Avi)
KGF-2/FGF-10 proteins coordinate embryonic development, regulate cell proliferation and differentiation, and are indispensable in branching morphogenesis. This multifunctional protein may aid in wound healing. KGF-2/FGF-10 Protein, Human (Biotinylated, His-Avi) is the recombinant human-derived KGF-2/FGF-10 protein, expressed by E. coli , with N-His, N-Avi labeled tag. The total length of KGF-2/FGF-10 Protein, Human (Biotinylated, His-Avi) is 171 a.a., with molecular weight of ~27 kDa.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
KGF-2/FGF-10 proteins coordinate embryonic development, regulate cell proliferation and differentiation, and are indispensable in branching morphogenesis. This multifunctional protein may aid in wound healing. KGF-2/FGF-10 Protein, Human (Biotinylated, His-Avi) is the recombinant human-derived KGF-2/FGF-10 protein, expressed by E. coli , with N-His, N-Avi labeled tag. The total length of KGF-2/FGF-10 Protein, Human (Biotinylated, His-Avi) is 171 a.a., with molecular weight of ~27 kDa.
Background
KGF-2/FGF-10 Protein assumes a crucial role in orchestrating embryonic development, exerting regulatory control over essential processes such as cell proliferation and differentiation. Its significance extends to the intricate domain of normal branching morphogenesis, where KGF-2/FGF-10 is indispensable. This versatile protein may also contribute to wound healing processes. Through crucial interactions, it engages with FGFR1 and FGFR2, forming molecular complexes that underlie its multifaceted functions. Furthermore, KGF-2/FGF-10 interacts with FGFBP1, emphasizing its intricate network of associations in orchestrating cellular responses and developmental events.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His;N-Avi
-
Accession
O15520 (Q38-S208)
-
Protein Length
Full Length of Mature Protein
-
Conjugation
Biotin
-
Synonyms
FGF10; Produced By Fibroblasts Of Urinary Bladder Lamina Propria; Fibroblast Growth Factor 10; Fibroblast Growth Factor; Keratinocyte Growth Factor 2; LADD3; FGF-10; FGF
-
AA Sequence
QALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS
-
Predicted Molecular Mass
23 kDa
-
Molecular Weight
Approximately 27 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<0.1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
