kshB Protein, Mycobacterium tuberculosis (His)
The kshB protein significantly degrades cholesterol by catalyzing the introduction of the 9a-hydroxyl moiety into 1,4-androstadiene-3,17-dione (ADD), resulting in the 9OHADD intermediate. It is spontaneously converted to HSA through the cleavage of the B ring and aromatization of the A ring. kshB Protein, Mycobacterium tuberculosis (His) is the recombinant kshB protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The kshB protein significantly degrades cholesterol by catalyzing the introduction of the 9a-hydroxyl moiety into 1,4-androstadiene-3,17-dione (ADD), resulting in the 9OHADD intermediate. It is spontaneously converted to HSA through the cleavage of the B ring and aromatization of the A ring. kshB Protein, Mycobacterium tuberculosis (His) is the recombinant kshB protein, expressed by E. coli , with N-6*His labeled tag.
The kshB Protein plays a crucial role in the degradation of cholesterol, catalyzing the introduction of a 9a-hydroxyl moiety into 1,4-androstadiene-3,17-dione (ADD) to generate the 9alpha-hydroxy-1,4-androstadiene-3,17-dione (9OHADD) intermediate. This intermediate undergoes spontaneous transformation into 3-hydroxy-9,10-seconandrost-1,3,5(10)-triene-9,17-dione (HSA) through the meta-cleavage of ring B, accompanied by the aromatization of ring A. Additionally, kshB exhibits versatility in substrate utilization, as it can also act on 4-androstene-3,17-dione (AD), 3-oxo-23,24-bisnorcholesta-4-en-22-oate (4-BNC), 3-oxo-23,24-bisnorcholesta-1,4-dien-22-oate (1,4-BNC), 3-oxo-23,24-bisnorcholesta-4-en-22-oyl-coenzyme A thioester (4-BNC-CoA), and 3-oxo-23,24-bisnorcholesta-1,4-dien-22-oyl-coenzyme A thioester (1,4-BNC-CoA) as substrates. This highlights the protein's pivotal role in cholesterol catabolism and its ability to engage in diverse metabolic pathways.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag N-6*His
-
Accession
P9WJ93 (M1-E358)
-
Gene ID887315
-
Molecular Construction
-
N-term
-
6*His
-
kshB (M1-E358)
Accession # P9WJ93 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
IMMT; Cell Proliferation-Inducing Gene 4/52 Protein; Inner Membrane Mitochondrial Protein; Mitochondrial Inner Membrane Protein; Mitofilin; Heart Muscle Protein; MINOS2; P87/89; HMP; Inner Membrane Protein, Mitochondrial (Mitofilin); MICOS Complex Subunit
-
AA Sequence
MTEAIGDEPLGDHVLELQIAEVVDETDEARSLVFAVPDGSDDPEIPPRRLRYAPGQFLTLRVPSERTGSVARCYSLCSSPYTDDALAVTVKRTADGYASNWLCDHAQVGMRIHVLAPSGNFVPTTLDADFLLLAAGSGITPIMSICKSALAEGGGQVTLLYANRDDRSVIFGDALRELAAKYPDRLTVLHWLESLQGLPSASALAKLVAPYTDRPVFICGPGPFMQAARDALAALKVPAQQVHIEVFKSLESDPFAAVKVDDSGDEAPATAVVELDGQTHTVSWPRTAKLLDVLLAAGLDAPFSCREGHCGACACTLRAGKVNMGVNDVLEQQDLDEGLILACQSRPESDSVEVTYDE
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
