1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. kshB Protein, Mycobacterium tuberculosis (His)

kshB Protein, Mycobacterium tuberculosis (His)

Cat. No.: HY-P701980
Handling Instructions Technical Support

The kshB protein significantly degrades cholesterol by catalyzing the introduction of the 9a-hydroxyl moiety into 1,4-androstadiene-3,17-dione (ADD), resulting in the 9OHADD intermediate. It is spontaneously converted to HSA through the cleavage of the B ring and aromatization of the A ring. kshB Protein, Mycobacterium tuberculosis (His) is the recombinant kshB protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The kshB protein significantly degrades cholesterol by catalyzing the introduction of the 9a-hydroxyl moiety into 1,4-androstadiene-3,17-dione (ADD), resulting in the 9OHADD intermediate. It is spontaneously converted to HSA through the cleavage of the B ring and aromatization of the A ring. kshB Protein, Mycobacterium tuberculosis (His) is the recombinant kshB protein, expressed by E. coli , with N-6*His labeled tag.

Background

The kshB Protein plays a crucial role in the degradation of cholesterol, catalyzing the introduction of a 9a-hydroxyl moiety into 1,4-androstadiene-3,17-dione (ADD) to generate the 9alpha-hydroxy-1,4-androstadiene-3,17-dione (9OHADD) intermediate. This intermediate undergoes spontaneous transformation into 3-hydroxy-9,10-seconandrost-1,3,5(10)-triene-9,17-dione (HSA) through the meta-cleavage of ring B, accompanied by the aromatization of ring A. Additionally, kshB exhibits versatility in substrate utilization, as it can also act on 4-androstene-3,17-dione (AD), 3-oxo-23,24-bisnorcholesta-4-en-22-oate (4-BNC), 3-oxo-23,24-bisnorcholesta-1,4-dien-22-oate (1,4-BNC), 3-oxo-23,24-bisnorcholesta-4-en-22-oyl-coenzyme A thioester (4-BNC-CoA), and 3-oxo-23,24-bisnorcholesta-1,4-dien-22-oyl-coenzyme A thioester (1,4-BNC-CoA) as substrates. This highlights the protein's pivotal role in cholesterol catabolism and its ability to engage in diverse metabolic pathways.

Species

Others

Source

E. coli

Tag

N-6*His

Accession

P9WJ93 (M1-E358)

Gene ID

887315

Molecular Construction
N-term
6*His
kshB (M1-E358)
Accession # P9WJ93
C-term
Protein Length

Full Length

Synonyms
hmp; 3-ketosteroid-9-alpha-monooxygenase; ferredoxin reductase component; 3-ketosteroid-9-alpha-hydroxylase; ferredoxin reductase component; KSH; Androsta-1; 4-diene-3; 17-dione 9-alpha-hydroxylase; Rieske-type oxygenase; RO
AA Sequence

MTEAIGDEPLGDHVLELQIAEVVDETDEARSLVFAVPDGSDDPEIPPRRLRYAPGQFLTLRVPSERTGSVARCYSLCSSPYTDDALAVTVKRTADGYASNWLCDHAQVGMRIHVLAPSGNFVPTTLDADFLLLAAGSGITPIMSICKSALAEGGGQVTLLYANRDDRSVIFGDALRELAAKYPDRLTVLHWLESLQGLPSASALAKLVAPYTDRPVFICGPGPFMQAARDALAALKVPAQQVHIEVFKSLESDPFAAVKVDDSGDEAPATAVVELDGQTHTVSWPRTAKLLDVLLAAGLDAPFSCREGHCGACACTLRAGKVNMGVNDVLEQQDLDEGLILACQSRPESDSVEVTYDE

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

kshB Protein, Mycobacterium tuberculosis (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

kshB Protein, Mycobacterium tuberculosis (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
kshB Protein, Mycobacterium tuberculosis (His)
Cat. No.:
HY-P701980
Quantity:
MCE Japan Authorized Agent: