L-selectin/CD62L Protein, Cynomolgus (HEK293, His)
Based on 1 Customer Validation
L-selectin/CD62L is a calcium-dependent lectin that aids cell adhesion by binding to neighboring glycoproteins. It mediates lymphocyte adhesion to endothelial cells in peripheral lymph nodes, causing leukocytes to tether and roll. L-selectin/CD62L Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived L-selectin/CD62L protein, expressed by HEK293 , with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
L-selectin/CD62L is a calcium-dependent lectin that aids cell adhesion by binding to neighboring glycoproteins. It mediates lymphocyte adhesion to endothelial cells in peripheral lymph nodes, causing leukocytes to tether and roll. L-selectin/CD62L Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived L-selectin/CD62L protein, expressed by HEK293 , with C-His labeled tag.
Background
L-selectin, a calcium-dependent lectin, facilitates cell adhesion by binding to glycoproteins on neighboring cells. It plays a significant role in the adherence of lymphocytes to endothelial cells in high endothelial venules of peripheral lymph nodes and promotes the initial tethering and rolling of leukocytes in endothelial tissues. The interaction between L-selectin and SELPLG/PSGL1 and PODXL2 is crucial for the recruitment and rolling of leukocytes, which relies on the sialyl Lewis X glycan modification of SELPLG and PODXL2, as well as the tyrosine sulfation modifications of SELPLG. Notably, sulfation on 'Tyr-51' of SELPLG is particularly important for the binding of L-selectin.
Verified Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. When 5 ×104cells/well are added to cyno L-Selectin coated plates (10 μg/mL, 100 μL/well), will induce 55.05% adhesion on U937 cells after 1 hour at 37°C.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-His
-
Accession
Q95198 (D29-N332)
-
Molecular Construction
-
N-term
-
L-selectin (D29-N332)
Accession # Q95198 -
His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
SELL; Lymphocyte Adhesion Molecule 1; Prev. LYAM1; Gp90-MEL; Prev. LNHR; Lyam-1; L-Selectin; LECAM1; LAM-1; HLHRc; PLNHR; Leu-8; CD62L; TQ1; LSEL; Leukocyte Adhesion Molecule 1; LAM1; Pln Homing Receptor; Leukocyte-Endothelial Cell Adhesion Molecule 1; CD
-
AA Sequence
DFLAHHGTDCWTYHYSENPMNWQKARRFCRENYTDLVAIQNKAEIEYLEKTLPFSPSYYWIGIRKIGGIWTWVGTNKSLTQEAENWGDGEPNNKKNKEDCVEIYIKRKKDAGKWNDDACHKPKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEPPKLGTMDCTHPLGDFSFSSQCAFNCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFSSACTFSCSEGTELIGEKKTICESSGIWSNPNPICQKLDRSFSMIKEGDYN
-
Molecular Weight
Approximately 52-63 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
