Copy Link Print Information

L-selectin/CD62L Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The L-selectin/CD62L protein is a calcium-dependent lectin that promotes cell adhesion by binding to glycoproteins on neighboring cells. L-selectin/CD62L Protein, Human (HEK293, His) is the recombinant human-derived L-selectin/CD62L protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for L-selectin/CD62L Protein, Human (HEK293, His)
  • Experimental Validation Results for L-selectin/CD62L Protein, Human (HEK293, His)
  • L-selectin/CD62L Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The L-selectin/CD62L protein is a calcium-dependent lectin that promotes cell adhesion by binding to glycoproteins on neighboring cells. L-selectin/CD62L Protein, Human (HEK293, His) is the recombinant human-derived L-selectin/CD62L protein, expressed by HEK293 , with C-His labeled tag.

Background

L-Selectin, also known as CD62L, is a calcium-dependent lectin that plays a crucial role in mediating cell adhesion by binding to glycoproteins on neighboring cells. Functionally, it facilitates the adherence of lymphocytes to endothelial cells within high endothelial venules in peripheral lymph nodes, promoting the initial tethering and rolling of leukocytes in endothelial tissues. L-Selectin's interaction with SELPLG/PSGL1 and PODXL2 is vital for the recruitment and rolling of leukocytes. This interaction is specifically dependent on the sialyl Lewis X glycan modification of SELPLG and PODXL2, along with tyrosine sulfation modifications of SELPLG. Notably, sulfation on 'Tyr-51' of SELPLG emerges as a critical factor for effective L-Selectin binding. The multifaceted functions of L-Selectin underscore its significance in orchestrating cell adhesion processes and immune cell recruitment.

Verified Bioactivity

Measured by the ability of the immobilized protein to support the adhesion of THP-1 human prostate cancer cells. The ED50 for this effect is 1.0-3.0 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by the ability of the immobilized protein to support the adhesion of THP-1 human prostate cancer cells. The ED50 for this effect is 2.231 μg/mL, corresponding to a specific activity is 448.230 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P14151 (W39-N332)

  • Gene ID
    6402  [NCBI]
  • Molecular Construction
    • N-term
    • L-selectin (W39-N332)
      Accession # P14151
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    SELL; Lymphocyte Adhesion Molecule 1; Prev. LYAM1; Gp90-MEL; Prev. LNHR; Lyam-1; L-Selectin; LECAM1; LAM-1; HLHRc; PLNHR; Leu-8; CD62L; TQ1; LSEL; Leukocyte Adhesion Molecule 1; LAM1; Pln Homing Receptor; Leukocyte-Endothelial Cell Adhesion Molecule 1; CD

  • AA Sequence

    WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYN

  • Molecular Weight

    Approximately 55-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by the ability of the immobilized protein to support the adhesion of THP-1 human prostate cancer cells. The ED50 for this effect is 2.231 μg/mL, corresponding to a specific activity is 448.230 units/mg.

  • L-selectin/CD62L Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for L-selectin/CD62L Protein, Human (HEK293, His)
  • Experimental Validation Results for L-selectin/CD62L Protein, Human (HEK293, His)
  • L-selectin/CD62L Protein, Human (HEK293, His) Product Image