Layilin/LAYN Protein, Rat (HEK293, His)

Layilin/LAYN Protein is a type 1 transmembrane protein with a C-type lectin motif that functions as a hyaluronic acid receptor. Layilin mainly localizes to mitochondria or in their close proximity. Layilin may lead to the promotion of the cell cycle through the activation of CDK1 in tumor cells, promotes mitochondrial fission through activation of DRP1 and accordingly enhance migratory and invasive abilities. Layilin/LAYN Protein, Rat (HEK293, His) is the recombinant rat-derived Layilin/LAYN protein, expressed by HEK293 , with C-His labeled tag.

Layilin (LAYN) is a type 1 transmembrane protein with a C-type lectin motif that functions as a hyaluronic acid receptor. Layilin interacts with cytoskeletal proteins such as talin, merlin, and radixin, and also with the leading edge of migrating cells and the surfaces of immune cells. Layilin mainly localizes to mitochondria or in their close proximity. It plays a role in the fission in mitochondrial dynamics through the activation of CDK1 and DRP1. Layilin may lead to the promotion of the cell cycle through the activation of CDK1 in tumor cells, promotes mitochondrial fission through activation of DRP1 and accordingly enhance migratory and invasive abilities. Layilin also up-regulates the expression of SNAI1 via down-regulation of MTA3, thereby enhanceing the invasive ability of malignant glioma cells. On a molecular level, layilin colocalized with integrin αLβ2 (LFA-1) on T cells, and cross-linking layilin promoted the activated state of this integrin, which is to promote antitumor immunity^[1][2].

Rat

HEK293

C-His

NP_001178926.1 (H25-E224)

500996  [NCBI]

Partial

HLLSGDLDPRGGQRFCWEGTRRPCYRVIYFHDTSQRRNFEEAKEACMKDGGQLASIETADEQRLIENFIESLQASDGDFWIGLKRLEEKQHNSTACQDLYAWTDGSLSQFRNWYMDEPSCESEVCVVMYHQPSAPPGIGGPYMFQWNDDRCNTKKNFICKYSDDKPSTTPSLSPGGEATEPAAPILPEETLEIDTKERRE

Approximately 34 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.