1. Recombinant Proteins
  2. Receptor Proteins
  3. Layilin/LAYN Protein, Rat (HEK293, His)

Layilin/LAYN Protein is a type 1 transmembrane protein with a C-type lectin motif that functions as a hyaluronic acid receptor. Layilin mainly localizes to mitochondria or in their close proximity. Layilin may lead to the promotion of the cell cycle through the activation of CDK1 in tumor cells, promotes mitochondrial fission through activation of DRP1 and accordingly enhance migratory and invasive abilities. Layilin/LAYN Protein, Rat (HEK293, His) is the recombinant rat-derived Layilin/LAYN protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Layilin/LAYN Protein is a type 1 transmembrane protein with a C-type lectin motif that functions as a hyaluronic acid receptor. Layilin mainly localizes to mitochondria or in their close proximity. Layilin may lead to the promotion of the cell cycle through the activation of CDK1 in tumor cells, promotes mitochondrial fission through activation of DRP1 and accordingly enhance migratory and invasive abilities. Layilin/LAYN Protein, Rat (HEK293, His) is the recombinant rat-derived Layilin/LAYN protein, expressed by HEK293 , with C-His labeled tag.

Background

Layilin (LAYN) is a type 1 transmembrane protein with a C-type lectin motif that functions as a hyaluronic acid receptor. Layilin interacts with cytoskeletal proteins such as talin, merlin, and radixin, and also with the leading edge of migrating cells and the surfaces of immune cells. Layilin mainly localizes to mitochondria or in their close proximity. It plays a role in the fission in mitochondrial dynamics through the activation of CDK1 and DRP1. Layilin may lead to the promotion of the cell cycle through the activation of CDK1 in tumor cells, promotes mitochondrial fission through activation of DRP1 and accordingly enhance migratory and invasive abilities. Layilin also up-regulates the expression of SNAI1 via down-regulation of MTA3, thereby enhanceing the invasive ability of malignant glioma cells. On a molecular level, layilin colocalized with integrin αLβ2 (LFA-1) on T cells, and cross-linking layilin promoted the activated state of this integrin, which is to promote antitumor immunity[1][2].

Species

Rat

Source

HEK293

Tag

C-His

Accession

NP_001178926.1 (H25-E224)

Gene ID
Molecular Construction
N-term
LAYN (H25-E224)
Accession # NP_001178926.1
His
C-term
Protein Length

Partial

Synonyms
Layilin; LAYN; LYAN
AA Sequence

HLLSGDLDPRGGQRFCWEGTRRPCYRVIYFHDTSQRRNFEEAKEACMKDGGQLASIETADEQRLIENFIESLQASDGDFWIGLKRLEEKQHNSTACQDLYAWTDGSLSQFRNWYMDEPSCESEVCVVMYHQPSAPPGIGGPYMFQWNDDRCNTKKNFICKYSDDKPSTTPSLSPGGEATEPAAPILPEETLEIDTKERRE

Predicted Molecular Mass
24.3 kDa
Molecular Weight

Approximately 34 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Layilin/LAYN Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Layilin/LAYN Protein, Rat (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Layilin/LAYN Protein, Rat (HEK293, His)
Cat. No.:
HY-P74777
Quantity:
MCE Japan Authorized Agent: