LIF Protein, Mouse (HEK293, Fc)

LIF (Leukemia Inhibitory Factor) prompts terminal differentiation in leukemic cells, inducing hematopoietic and neuronal cell differentiation.It also stimulates acute-phase protein synthesis in hepatocytes.LIF's multifaceted role underscores its significance in regulating hematopoiesis, neurogenesis, and hepatic responses.LIF Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived LIF protein, expressed by HEK293 , with C-hFc labeled tag.

LIF (Leukemia Inhibitory Factor) exhibits the capability to prompt terminal differentiation in leukemic cells, showcasing a diverse range of activities. Notably, it induces hematopoietic differentiation in both normal and myeloid leukemia cells, facilitates neuronal cell differentiation, and stimulates the synthesis of acute-phase proteins in hepatocytes. This multifaceted role underscores LIF's significance in orchestrating various cellular processes, contributing to the regulation of hematopoiesis, neurogenesis, and hepatic responses.

Measured in a cell proliferation assay using C2C12 cells. The ED₅₀ for this effect is 0.3259 ng/mL, corresponding to a specific activity is 3.06×10⁶ units/mg.

• 
  Measured in a cell proliferation assay using C2C12 cells. The ED₅₀ for this effect is 0.3259 ng/mL, corresponding to a specific activity is 3.06×10⁶ units/mg.

Mouse

HEK293

C-hFc

P09056 (P25-F203)

16878  [NCBI]

Full Length of Mature Protein

PLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF

Approximately 65-70 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.