LILRA5/CD85f Protein, Human (HEK293, Fc)

The LILRA5/CD85f protein may trigger innate immune responses independently of recognition of MHC class I antigens. This unique feature suggests a unique role in early defense against pathogens, acting through a pathway that is independent of MHC class I antigen recognition. LILRA5/CD85f Protein, Human (HEK293, Fc) is the recombinant human-derived LILRA5/CD85f protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The LILRA5/CD85f protein may trigger innate immune responses independently of recognition of MHC class I antigens. This unique feature suggests a unique role in early defense against pathogens, acting through a pathway that is independent of MHC class I antigen recognition. LILRA5/CD85f Protein, Human (HEK293, Fc) is the recombinant human-derived LILRA5/CD85f protein, expressed by HEK293 , with C-hFc labeled tag.

Background

LILRA5/CD85f Protein is suggested to potentially play a role in triggering innate immune responses, indicating its involvement in the early defense mechanisms against pathogens. However, it does not appear to have a role in recognizing any class I major histocompatibility complex (MHC) antigens. This distinctive feature suggests that LILRA5/CD85f may exert its immune-modulating effects through pathways independent of class I MHC antigen recognition, highlighting its unique role in the intricate landscape of innate immune responses. The specific molecular mechanisms underlying its participation in triggering innate immunity remain to be fully elucidated, warranting further exploration into its functional significance in the context of the immune system.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • LILRA5 (G42-R268)
      Accession # A6NI73-1
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    LILRA5; Leucocyte Ig-Like Receptor A5; Prev. LILRB7; LIR-9; ILT11; Leukocyte Immunoglobulin-Like Receptor, Subfamily B (With TM And ITIM Domains), Member 7; LIR9; Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 5 Soluble; CD85f; Immunoglobulin-L

  • AA Sequence

    GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR

  • Predicted Molecular Mass

    52 kDa

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00