LILRB1/CD85j/ILT2 Protein, Human (346a.a, HEK293, His)

The LILRB1/CD85j/ILT2 protein is a receptor for class I MHC antigens and recognizes multiple HLA alleles and H301/UL18 (human cytomegalovirus MHC homolog). Ligand binding induces inhibitory signals that downregulate immune responses. LILRB1/CD85j/ILT2 Protein, Human (346a.a, HEK293, His) is the recombinant human-derived LILRB1/CD85j/ILT2 protein, expressed by HEK293 , with C-His labeled tag.

The LILRB1/CD85j/ILT2 Protein serves as a receptor for class I MHC antigens, demonstrating recognition across a broad spectrum of HLA-A, HLA-B, HLA-C, HLA-G, and HLA-F alleles. Additionally, it acts as a receptor for H301/UL18, a human cytomegalovirus class I MHC homolog. Ligand binding induces inhibitory signals, leading to the down-regulation of the immune response. The engagement of LILRB1 by class I MHC molecules on natural killer cells or T-cells protects target cells from lysis, and interaction with HLA-B or HLA-E inhibits FCER1A signaling and serotonin release. Moreover, LILRB1 inhibits FCGR1A-mediated cellular responses, including phosphorylation of proteins and mobilization of intracellular calcium ions. It recognizes HLA-G in complex with B2M/beta-2 microglobulin and a nonamer self-peptide, triggering the secretion of growth-promoting factors by decidual NK cells. Additionally, it reprograms B cells toward an immune suppressive phenotype. LILRB1 binds PTPN6 when phosphorylated and interacts with FCER1A, FCGR1A, and the UL18 protein from human cytomegalovirus. It also interacts with peptide-bound HLA-G-B2M and HLA-F-B2M complexes, highlighting its diverse roles in immune modulation and viral recognition.

Human

HEK293

C-8*His

Q8NHL6-1 (L116-V461)

10859  [NCBI]

Partial

LVVTGAYIKPTLSAQPSPVVNSGGNVILQCDSQVAFDGFSLCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHLGV

Approximately 55-68 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.