LILRB5/CD85c/LIR-8 Protein, Human (Biotinylated, HEK293, His-Avi)
The LILRB5/CD85c/LIR-8 protein functions as a receptor for class I MHC antigens, suggesting a critical role in immune recognition and regulation. Its interaction with MHC class I molecules suggests involvement in surveillance and may influence immune responses. LILRB5/CD85c/LIR-8 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived LILRB5/CD85c/LIR-8 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The LILRB5/CD85c/LIR-8 protein functions as a receptor for class I MHC antigens, suggesting a critical role in immune recognition and regulation. Its interaction with MHC class I molecules suggests involvement in surveillance and may influence immune responses. LILRB5/CD85c/LIR-8 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived LILRB5/CD85c/LIR-8 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
LILRB5/CD85c/LIR-8 Protein appears to function as a receptor for class I MHC antigens, suggesting a pivotal role in immune recognition and modulation. Its capacity to interact with class I MHC molecules underscores its involvement in monitoring and potentially influencing immune responses. As a receptor, LILRB5 may contribute to the regulation of immune activities, particularly in the context of recognizing and responding to cells displaying class I MHC antigens. Further exploration of LILRB5's interactions and its impact on immune signaling could enhance our understanding of its role as a receptor and its potential implications in immune surveillance and modulation.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
O75023-1 (R18-H456)
-
Molecular Construction
-
N-term
-
LILRB5 (R18-H456)
Accession # O75023-1 -
8*His-Avi
-
C-term
-
-
Protein Length
Partial
-
Conjugation
Biotin
-
Synonyms
LILRB5; Leukocyte Immunoglobulin-Like Receptor 8; Leukocyte Immunoglobulin Like Receptor B5; CD85 Antigen-Like Family Member C; LIR-8; Leucocyte Ig-Like Receptor B5; LIR8; Leukocyte Immunoglobulin Like Receptor B5 Short Splicing Isoform; CD85c; Leukocyte
-
AA Sequence
RTCVQAGTLPKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATGFYAEPTLLALPSPVVASGGNVTLQCDTLDGLLTFVLVEEEQKLPRTLYSQKLPKGPSQALFPVGPVTPSCRWRFRCYYYYRKNPQVWSNPSDLLEILVPGVSRKPSLLIPQGSVVARGGSLTLQCRSDVGYDIFVLYKEGEHDLVQGSGQQPQAGLSQANFTLGPVSRSHGGQYRCYGAHNLSPRWSAPSDPLDILIAGLIPDIPALSVQPGPKVASGENVTLLCQSWHQIDTFFLTKEGAAHPPLCLKSKYQSYRHQAEFSMSPVTSAQGGTYRCYSAIRSYPYLLSSPSYPQELVVSGPSGDPSLSPTGSTPTPGPEDQPLTPTGLDPQSGLGRH
-
Predicted Molecular Mass
49.9 kDa
-
Molecular Weight
Approximately 65-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)