1. Recombinant Proteins
  2. Receptor Proteins
  3. Leukocyte Immunoglobin-like Receptors
  4. Leukocyte Immunoglobulin Like Receptor B5/LIR-8
  5. LILRB5/CD85c/LIR-8 Protein, Human (HEK293, His-Avi)

LILRB5/CD85c/LIR-8 Protein, Human (HEK293, His-Avi)

Cat. No.: HY-P78485
Handling Instructions Technical Support

The LILRB5/CD85c/LIR-8 protein functions as a receptor for class I MHC antigens, suggesting a critical role in immune recognition and regulation. Its interaction with MHC class I molecules suggests involvement in surveillance and may influence immune responses. LILRB5/CD85c/LIR-8 Protein, Human (HEK293, His-Avi) is the recombinant human-derived LILRB5/CD85c/LIR-8 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LILRB5/CD85c/LIR-8 protein functions as a receptor for class I MHC antigens, suggesting a critical role in immune recognition and regulation. Its interaction with MHC class I molecules suggests involvement in surveillance and may influence immune responses. LILRB5/CD85c/LIR-8 Protein, Human (HEK293, His-Avi) is the recombinant human-derived LILRB5/CD85c/LIR-8 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

LILRB5/CD85c/LIR-8 Protein appears to function as a receptor for class I MHC antigens, suggesting a pivotal role in immune recognition and modulation. Its capacity to interact with class I MHC molecules underscores its involvement in monitoring and potentially influencing immune responses. As a receptor, LILRB5 may contribute to the regulation of immune activities, particularly in the context of recognizing and responding to cells displaying class I MHC antigens. Further exploration of LILRB5's interactions and its impact on immune signaling could enhance our understanding of its role as a receptor and its potential implications in immune surveillance and modulation.

Species

Human

Source

HEK293

Tag

C-Avi;C-8*His

Accession

O75023-1 (R18-H456)

Gene ID
Molecular Construction
N-term
LILRB5 (R18-H456)
Accession # O75023-1
8*His-Avi
C-term
Protein Length

Partial

Synonyms
CD85C ; LIR-8; LIR8
AA Sequence

RTCVQAGTLPKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATGFYAEPTLLALPSPVVASGGNVTLQCDTLDGLLTFVLVEEEQKLPRTLYSQKLPKGPSQALFPVGPVTPSCRWRFRCYYYYRKNPQVWSNPSDLLEILVPGVSRKPSLLIPQGSVVARGGSLTLQCRSDVGYDIFVLYKEGEHDLVQGSGQQPQAGLSQANFTLGPVSRSHGGQYRCYGAHNLSPRWSAPSDPLDILIAGLIPDIPALSVQPGPKVASGENVTLLCQSWHQIDTFFLTKEGAAHPPLCLKSKYQSYRHQAEFSMSPVTSAQGGTYRCYSAIRSYPYLLSSPSYPQELVVSGPSGDPSLSPTGSTPTPGPEDQPLTPTGLDPQSGLGRH

Predicted Molecular Mass
49.9 kDa
Molecular Weight

Approximately 67-72 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

LILRB5/CD85c/LIR-8 Protein, Human (HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

LILRB5/CD85c/LIR-8 Protein, Human (HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LILRB5/CD85c/LIR-8 Protein, Human (HEK293, His-Avi)
Cat. No.:
HY-P78485
Quantity:
MCE Japan Authorized Agent: