LILRB5/CD85c/LIR-8 Protein, Human (HEK293, His-Avi)

The LILRB5/CD85c/LIR-8 protein functions as a receptor for class I MHC antigens, suggesting a critical role in immune recognition and regulation. Its interaction with MHC class I molecules suggests involvement in surveillance and may influence immune responses. LILRB5/CD85c/LIR-8 Protein, Human (HEK293, His-Avi) is the recombinant human-derived LILRB5/CD85c/LIR-8 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The LILRB5/CD85c/LIR-8 protein functions as a receptor for class I MHC antigens, suggesting a critical role in immune recognition and regulation. Its interaction with MHC class I molecules suggests involvement in surveillance and may influence immune responses. LILRB5/CD85c/LIR-8 Protein, Human (HEK293, His-Avi) is the recombinant human-derived LILRB5/CD85c/LIR-8 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

LILRB5/CD85c/LIR-8 Protein appears to function as a receptor for class I MHC antigens, suggesting a pivotal role in immune recognition and modulation. Its capacity to interact with class I MHC molecules underscores its involvement in monitoring and potentially influencing immune responses. As a receptor, LILRB5 may contribute to the regulation of immune activities, particularly in the context of recognizing and responding to cells displaying class I MHC antigens. Further exploration of LILRB5's interactions and its impact on immune signaling could enhance our understanding of its role as a receptor and its potential implications in immune surveillance and modulation.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • LILRB5 (R18-H456)
      Accession # O75023-1
    • 8*His-Avi
    • C-term
  • Protein Length

    Partial

  • Synonyms

    LILRB5; Leukocyte Immunoglobulin-Like Receptor 8; Leukocyte Immunoglobulin Like Receptor B5; CD85 Antigen-Like Family Member C; LIR-8; Leucocyte Ig-Like Receptor B5; LIR8; Leukocyte Immunoglobulin Like Receptor B5 Short Splicing Isoform; CD85c; Leukocyte

  • AA Sequence

    RTCVQAGTLPKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATGFYAEPTLLALPSPVVASGGNVTLQCDTLDGLLTFVLVEEEQKLPRTLYSQKLPKGPSQALFPVGPVTPSCRWRFRCYYYYRKNPQVWSNPSDLLEILVPGVSRKPSLLIPQGSVVARGGSLTLQCRSDVGYDIFVLYKEGEHDLVQGSGQQPQAGLSQANFTLGPVSRSHGGQYRCYGAHNLSPRWSAPSDPLDILIAGLIPDIPALSVQPGPKVASGENVTLLCQSWHQIDTFFLTKEGAAHPPLCLKSKYQSYRHQAEFSMSPVTSAQGGTYRCYSAIRSYPYLLSSPSYPQELVVSGPSGDPSLSPTGSTPTPGPEDQPLTPTGLDPQSGLGRH

  • Predicted Molecular Mass

    49.9 kDa

  • Molecular Weight

    Approximately 67-72 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00