LIN28A Protein, Human (His, SUMO)
LIN28A Protein, Human (His, SUMO) is the recombinant human-derived LIN28A protein, expressed by E. coli, with N-6*His & N-SUMO tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
LIN28A Protein, Human (His, SUMO) is the recombinant human-derived LIN28A protein, expressed by E. coli, with N-6*His & N-SUMO tag.
Background
LIN28 is an RNA-binding protein that inhibits the processing of pre-let-7 miRNAs and regulates the translation of mRNAs involved in developmental timing, pluripotency, and metabolism (e.g., binding IGF2 mRNA, MYOD1 mRNA). It recognizes G-quartet (G4) structural features in miRNA/mRNA targets, acting as a 'translational enhancer' to drive specific mRNAs to polysomes and boost protein synthesis. By associating with the translational machinery, LIN28 increases initiation events per mRNA and stabilizes mRNAs indirectly. It recruits TUT4/TUT7 uridylyltransferases to uridylate pre-miRNAs (e.g., let-7, miR-143), leading to their Dicer-blocked degradation, thereby maintaining embryonic stem cell pluripotency (similar mechanisms apply to miR107, miR-200c). Localized near the ER, LIN28 suppresses translation of ER-targeted mRNAs (e.g., transmembrane/secretory proteins) but enhances translation of metabolic enzymes (e.g., PFKP, PDHA1, SDHA), promoting glycolysis and oxidative phosphorylation (by similarity suggests a role in adult tissue repair).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;N-SUMO
-
Accession
Q9H9Z2 (M1-N209)
-
Gene ID79727
-
Molecular Construction
-
N-term
-
6*His
-
SUMO
-
LIN28A (M1-N209)
Accession # Q9H9Z2 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
LIN28A; Zinc Finger CCHC Domain-Containing Protein 1; Prev. LIN28; FLJ12457; ZCCHC1; Lin-28A; CSDD1; Zinc Finger, CCHC Domain Containing 1; Lin-28 Homolog A; Lin-28 Homolog (C. Elegans); LIN-28; RNA-Binding Protein LIN-28; Lin-28 RNA Binding Posttranscrip
-
AA Sequence
MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN
-
Predicted Molecular Mass
35.7 kDa
-
Molecular Weight
Approximately 40-45 kDa, based on SDS-PAGE under reducing conditions.
-
Structure/Form
Monomer
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
