LILRB1/CD85j/ILT2 Protein, Human (Biotinylated, HEK293, His-Avi)
LILRB1/CD85j/ILT2 Protein is an inhibitory receptor broadly expressed on leukocytes. LILRB1 recognises a wide range of classical HLA-class I allelic variants, as well as the non-classical molecules HLA-F and -G by binding to the conserved a3 domain. LILRB1 also recognises the human CMV-encoded MHC class I homologue UL18. LILRB1 is encoded within the leukocyte receptor complex on 19q13.4. LILRB1 can function as a negative regulator of BiTE molecule-induced tumor cell killing. LILRB1 acts as a novel checkpoint inhibitory molecule capable of restricting BiTE molecule-mediated CD8+ T cell effector function. LILRB1/CD85j/ILT2 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived LILRB1/CD85j/ILT2 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
LILRB1/CD85j/ILT2 Protein is an inhibitory receptor broadly expressed on leukocytes. LILRB1 recognises a wide range of classical HLA-class I allelic variants, as well as the non-classical molecules HLA-F and -G by binding to the conserved a3 domain. LILRB1 also recognises the human CMV-encoded MHC class I homologue UL18. LILRB1 is encoded within the leukocyte receptor complex on 19q13.4. LILRB1 can function as a negative regulator of BiTE molecule-induced tumor cell killing. LILRB1 acts as a novel checkpoint inhibitory molecule capable of restricting BiTE molecule-mediated CD8+ T cell effector function[1][2][3][4]. LILRB1/CD85j/ILT2 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived LILRB1/CD85j/ILT2 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.
Background
LILRB1 binds MHC class I and also contain immunoreceptor tyrosine-based inhibitory motifs involved in the intracellular transduction of inhibitory signaling, which establishes them as strong candidates for MHC class I-mediated suppression of phagocytosis[1].
LILRB1 and PD1 shows nonoverlapping expression patterns across CD8+ TEM and TEMRA subsets, and blocking both pathways synergistically enhanced CD8+ T cell function. LILRB1 is highly expressed by the CD8+ TEMRA subset, which is the most potent population for BiTE molecule–induced toxicity. LILRB1-expressing CD8+ T cells infiltrate solid tumors. LILRB1 blockade increases CD8+ T cell cytolytic activity in vitro[3].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-6*His
-
Accession
D9IDM8 (G24-H458)
-
Gene ID10859
-
Molecular Construction
-
N-term
-
LILRB1 (G24-H458)
Accession # D9IDM8 -
6*His-Avi
-
C-term
-
-
Protein Length
Partial
-
Conjugation
Biotin
-
Conjugate Method
The single lysine residue in Avitag is biotinylated through an enzymatic reaction.
-
Synonyms
LILRB1; CD85 Antigen-Like Family Member J; Leukocyte Immunoglobulin Like Receptor B1; Myeloid Inhibitory Receptor 7; LIR-1; Leucocyte Ig-Like Receptor B1; MIR-7; ILT-2; ILT2; CD85; LIR1; MIR7; CD85j; Immunoglobulin Heavy Chain Variable Region; PIR-B; Leuk
-
AA Sequence
GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTAPWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRH
-
Predicted Molecular Mass
50 kDa
-
Molecular Weight
Approximately 70-90 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
References
[1]. Kimiko Kuroki, et al. Extensive polymorphisms of LILRB1 (ILT2, LIR1) and their association with HLA-DRB1 shared epitope negative rheumatoid arthritis. Hum Mol Genet. 2005 Aug 15;14(16):2469-80. [Content Brief]
[2]. Amira A Barkal, et al. Engagement of MHC class I by the inhibitory receptor LILRB1 suppresses macrophages and is a target of cancer immunotherapy. Nat Immunol. 2018 Jan;19(1):76-84. [Content Brief]
[3]. Aeryon Kim, et al. LILRB1 Blockade Enhances Bispecific T Cell Engager Antibody-Induced Tumor Cell Killing by Effector CD8+ T Cells. J Immunol. 2019 Aug 15;203(4):1076-1087. [Content Brief]
[4]. Des C Jones, et al. Alternative mRNA splicing creates transcripts encoding soluble proteins from most LILR genes. Eur J Immunol. 2009 Nov;39(11):3195-206. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
