1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins STE
  4. Serine/Threonine Kinase 10
  5. LOK Protein, Human (Active, His)

LOK is an important serine/threonine protein kinase that significantly regulates lymphocyte migration by phosphorylating MSN and potentially PLK1. It acts as a negative regulator of MAP3K1/MEKK1. LOK Protein, Human (His) is the recombinant human-derived LOK protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LOK is an important serine/threonine protein kinase that significantly regulates lymphocyte migration by phosphorylating MSN and potentially PLK1. It acts as a negative regulator of MAP3K1/MEKK1. LOK Protein, Human (His) is the recombinant human-derived LOK protein, expressed by E. coli , with N-His labeled tag.

Background

LOK, a serine/threonine-protein kinase, plays a significant role in the regulation of lymphocyte migration. It achieves this by phosphorylating key targets such as MSN and potentially PLK1, while also acting as a negative regulator of MAP3K1/MEKK1. LOK's involvement in the orchestration of lymphocyte migration is particularly notable, as it mediates the phosphorylation of ERM proteins, exemplified by MSN. Moreover, LOK may extend its influence as a cell cycle regulator, potentially functioning as a polo kinase kinase, as suggested by its ability to phosphorylate PLK1 in vitro; however, the confirmation of such regulatory roles in vivo awaits additional empirical evidence.

Biological Activity

The specific activity was determined to be >200 nmol/min/mg using synthetic AXLtide peptide (KKSRGDYMTMQIG) as substrate.

Species

Human

Source

E. coli

Tag

N-His

Accession

O94804 (R18-E317)

Gene ID
Molecular Construction
N-term
His
LOK (R18-E317)
Accession # O94804
C-term
Protein Length

Partial

Synonyms
Serine/threonine-protein kinase 10; STK10; LOK
AA Sequence

RKSREYEHVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGALAAAKVIETKSEEELEDYIVEIEILATCDHPYIVKLLGAYYHDGKLWIMIEFCPGGAVDAIMLELDRGLTEPQIQVVCRQMLEALNFLHSKRIIHRDLKAGNVLMTLEGDIRLADFGVSAKNLKTLQKRDSFIGTPYWMAPEVVMCETMKDTPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSDPPTLLTPSKWSVEFRDFLKIALDKNPETRPSAAQLLEHPFVSSITSNKALRELVAEAKAEVMEE

Predicted Molecular Mass
36 kDa
Molecular Weight

Approximately 40 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

LOK Protein, Human (Active, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LOK Protein, Human (Active, His)
Cat. No.:
HY-P73282
Quantity:
MCE Japan Authorized Agent: