LOK Protein, Human (Active, His)
Based on 1 Customer Validation
LOK is an important serine/threonine protein kinase that significantly regulates lymphocyte migration by phosphorylating MSN and potentially PLK1. It acts as a negative regulator of MAP3K1/MEKK1. LOK Protein, Human (His) is the recombinant human-derived LOK protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
LOK is an important serine/threonine protein kinase that significantly regulates lymphocyte migration by phosphorylating MSN and potentially PLK1. It acts as a negative regulator of MAP3K1/MEKK1. LOK Protein, Human (His) is the recombinant human-derived LOK protein, expressed by E. coli , with N-His labeled tag.
Background
LOK, a serine/threonine-protein kinase, plays a significant role in the regulation of lymphocyte migration. It achieves this by phosphorylating key targets such as MSN and potentially PLK1, while also acting as a negative regulator of MAP3K1/MEKK1. LOK's involvement in the orchestration of lymphocyte migration is particularly notable, as it mediates the phosphorylation of ERM proteins, exemplified by MSN. Moreover, LOK may extend its influence as a cell cycle regulator, potentially functioning as a polo kinase kinase, as suggested by its ability to phosphorylate PLK1 in vitro; however, the confirmation of such regulatory roles in vivo awaits additional empirical evidence.
Verified Bioactivity
The specific activity was determined to be >200 nmol/min/mg using synthetic AXLtide peptide (KKSRGDYMTMQIG) as substrate.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
O94804 (R18-E317)
-
Molecular Construction
-
N-term
-
His
-
LOK (R18-E317)
Accession # O94804 -
C-term
-
-
Protein Length
Partial
-
Synonyms
STK10; PRO2729; Serine/Threonine Kinase 10; Serine/Threonine-Protein Kinase 10; LOK; Non-Specific Serine/Threonine Protein Kinase; Lymphocyte-Oriented Kinase
-
AA Sequence
RKSREYEHVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGALAAAKVIETKSEEELEDYIVEIEILATCDHPYIVKLLGAYYHDGKLWIMIEFCPGGAVDAIMLELDRGLTEPQIQVVCRQMLEALNFLHSKRIIHRDLKAGNVLMTLEGDIRLADFGVSAKNLKTLQKRDSFIGTPYWMAPEVVMCETMKDTPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSDPPTLLTPSKWSVEFRDFLKIALDKNPETRPSAAQLLEHPFVSSITSNKALRELVAEAKAEVMEE
-
Predicted Molecular Mass
36 kDa
-
Molecular Weight
Approximately 40 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
