LOXL3 Protein, Human (sf9, GST)

LOXL3 Protein, Human (sf9, GST) is the recombinant human-derived LOXL3, expressed by Sf9 insect cells , with GST labeled tag. ,

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

LOXL3 Protein, Human (sf9, GST) is the recombinant human-derived LOXL3, expressed by Sf9 insect cells , with GST labeled tag. ,

Background

LOXL3 is a protein-lysine 6-oxidase that mediates the oxidation of peptidyl lysine residues to allysine in target proteins. It catalyzes the post-translational oxidative deamination of peptidyl lysine residues in precursors of elastin and various collagens, a prerequisite for the formation of cross-links between collagens and elastin. LOXL3 is involved in somite boundary formation by oxidizing fibronectin (FN1), enhancing integrin signaling in myofibers and their adhesion to the myotendinous junction (MTJ) (by similar). Additionally, LOXL3 regulates the inflammatory response by interacting with STAT3 in the nucleus and catalyzing both deacetylation and oxidation of lysine residues on STAT3, disrupting STAT3 dimerization and inhibiting its transcription activity, thereby suppressing the differentiation of naive CD4(+) T-cells into T-helper Th17 or regulatory T-cells (Treg). Oxidation of lysine residues on STAT3 preferentially occurs on acetylated lysines, and LOXL3 can also catalyze the deacetylation of lysine residues on STAT3.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag GST
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    LOXL3; Alternative Protein LOXL3; Lysyl Oxidase Like 3; Lysyl Oxidase Homolog; Lysyl Oxidase-Like Protein 3; Lysyl Oxidase-Like 3; Lysyl Oxidase Homolog 3; MYP28; LOXL

  • AA Sequence

    ETASDLLLHSALVQETAYIEDRPLHMLYCAAEENCLASSARSANWPYGHRRLLRFSSQIHNLGRADFRPKAGRHSWVWHECHGHYHSMDIFTHYDILTPNGTKVAEGHKASFCLEDTECQEDVSKRYECANFGEQGITVGCWDLYRHDIDCQWIDITDVKPGNYILQVVINPNFEVAESDFTNNAMKCNCKYDGHRIWVHNCHIGDAFSEEANRRFERYPGQTSNQII

  • Molecular Weight

    Approximately 54 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00