1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. LOXL3 Protein, Human (sf9, GST)

LOXL3 Protein, Human (sf9, GST) is the recombinant human-derived LOXL3, expressed by Sf9 insect cells , with GST labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
20 μg Ask For Quote & Lead Time
100 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LOXL3 Protein, Human (sf9, GST) is the recombinant human-derived LOXL3, expressed by Sf9 insect cells , with GST labeled tag. ,

Background

LOXL3 is a protein-lysine 6-oxidase that mediates the oxidation of peptidyl lysine residues to allysine in target proteins. It catalyzes the post-translational oxidative deamination of peptidyl lysine residues in precursors of elastin and various collagens, a prerequisite for the formation of cross-links between collagens and elastin. LOXL3 is involved in somite boundary formation by oxidizing fibronectin (FN1), enhancing integrin signaling in myofibers and their adhesion to the myotendinous junction (MTJ) (by similar). Additionally, LOXL3 regulates the inflammatory response by interacting with STAT3 in the nucleus and catalyzing both deacetylation and oxidation of lysine residues on STAT3, disrupting STAT3 dimerization and inhibiting its transcription activity, thereby suppressing the differentiation of naive CD4(+) T-cells into T-helper Th17 or regulatory T-cells (Treg). Oxidation of lysine residues on STAT3 preferentially occurs on acetylated lysines, and LOXL3 can also catalyze the deacetylation of lysine residues on STAT3.

Species

Human

Source

Sf9 insect cells

Tag

GST

Accession

P58215-1 (E526-I753)

Gene ID

84695

Protein Length

Partial

Synonyms
LOXL
AA Sequence

ETASDLLLHSALVQETAYIEDRPLHMLYCAAEENCLASSARSANWPYGHRRLLRFSSQIHNLGRADFRPKAGRHSWVWHECHGHYHSMDIFTHYDILTPNGTKVAEGHKASFCLEDTECQEDVSKRYECANFGEQGITVGCWDLYRHDIDCQWIDITDVKPGNYILQVVINPNFEVAESDFTNNAMKCNCKYDGHRIWVHNCHIGDAFSEEANRRFERYPGQTSNQII

Predicted Molecular Mass
54 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Documentation

LOXL3 Protein, Human (sf9, GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

LOXL3 Protein, Human (sf9, GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LOXL3 Protein, Human (sf9, GST)
Cat. No.:
HY-P703035
Quantity:
MCE Japan Authorized Agent: