LRRC32 Protein, Human (HEK293, Fc)

LRRC32 is a key regulator of TGF-β activation and maintains TGFB1, TGFB2, and TGFB3 in the latent state during extracellular storage by binding to latency-associated peptide (LAP). LRRC32 competes with LTBP1 for LAP binding and effectively regulates integrin-dependent TGF-β activation. LRRC32 Protein, Human (HEK293, Fc) is the recombinant human-derived LRRC32 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of LRRC32 Protein, Human (HEK293, Fc) is 608 a.a., with molecular weight of 104-110.0 kDa.

LRRC32, a crucial regulator of transforming growth factor beta (TGFB1, TGFB2, and TGFB3), plays a pivotal role in controlling TGF-beta activation by maintaining it in a latent state during extracellular storage. Specifically associating with the Latency-associated peptide (LAP), the regulatory chain of TGF-beta, LRRC32 exerts its regulatory influence on integrin-dependent TGF-beta activation. Notably, LRRC32 competes effectively with LTBP1 for LAP binding, further modulating TGF-beta activation. Its significance extends to the regulation of TGF-beta-1 (TGFB1) activation on the surface of activated regulatory T-cells (Tregs). Moreover, LRRC32's involvement is essential for epithelial fusion during palate development, where it regulates the activation of TGF-beta-3 (TGFB3). Interacting directly with TGFB1, TGFB2, and TGFB3, LRRC32's association with LAP regulates the activation of TGF-beta-1 and TGF-beta-3, highlighting its intricate role in fine-tuning TGF-beta signaling. Additionally, LRRC32 interacts with LAPTM4B, contributing to the reduction of TGFB1 production in regulatory T-cells.

Human

HEK293

C-hFc

Q14392 (H20-N627)

2615  [NCBI]

HQDKVPCKMVDKKVSCQVLGLLQVPSVLPPDTETLDLSGNQLRSILASPLGFYTALRHLDLSTNEISFLQPGAFQALTHLEHLSLAHNRLAMATALSAGGLGPLPRVTSLDLSGNSLYSGLLERLLGEAPSLHTLSLAENSLTRLTRHTFRDMPALEQLDLHSNVLMDIEDGAFEGLPRLTHLNLSRNSLTCISDFSLQQLRVLDLSCNSIEAFQTASQPQAEFQLTWLDLRENKLLHFPDLAALPRLIYLNLSNNLIRLPTGPPQDSKGIHAPSEGWSALPLSAPSGNASGRPLSQLLNLDLSYNEIELIPDSFLEHLTSLCFLNLSRNCLRTFEARRLGSLPCLMLLDLSHNALETLELGARALGSLRTLLLQGNALRDLPPYTFANLASLQRLNLQGNRVSPCGGPDEPGPSGCVAFSGITSLRSLSLVDNEIELLRAGAFLHTPLTELDLSSNPGLEVATGALGGLEASLEVLALQGNGLMVLQVDLPCFICLKRLNLAENRLSHLPAWTQAVSLEVLDLRNNSFSLLPGSAMGGLETSLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEKGGLKNIN

104-110.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.