Copy Link Print Information

Lumican/LUM Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

Lumican, also known as LUM protein, is a protein with the ability to bind to laminin. Laminin is a key component of the extracellular matrix, a complex network of molecules that provides structural support to tissues. Lumican/LUM Protein, Human (HEK293, His) is the recombinant human-derived Lumican/LUM protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Lumican/LUM Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Lumican, also known as LUM protein, is a protein with the ability to bind to laminin. Laminin is a key component of the extracellular matrix, a complex network of molecules that provides structural support to tissues. Lumican/LUM Protein, Human (HEK293, His) is the recombinant human-derived Lumican/LUM protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Lumican, also known as LUM protein, is a protein that possesses the ability to bind to laminin. Laminin is a key component of the extracellular matrix, a complex network of molecules that provides structural support to tissues. The binding of lumican to laminin suggests its involvement in the regulation of cellular interactions and tissue organization. However, further research is required to fully understand the specific mechanisms and functional implications of lumican's interaction with laminin, as well as its potential role in various physiological and pathological processes.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P51884 (Q19-N338)

  • Gene ID
    4060  [NCBI]
  • Molecular Construction
    • N-term
    • Lumican (Q19-N338)
      Accession # P51884
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    LUM; Keratan Sulfate Proteoglycan Lumican; Prev. LDC; KSPG Lumican; SLRR2D; Epididymis Secretory Sperm Binding Protein; Lumican; Lumican Proteoglycan

  • AA Sequence

    QYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN

  • Predicted Molecular Mass

    37.7 kDa

  • Molecular Weight

    Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 1 mM EDTA, pH 7.2.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 8% Trehalose, 4% Mannitol, 1 mM EDTA, 0.02% Twenn80, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Lumican/LUM Protein, Human (HEK293, His) Product Image
    1/16
  • Lumican/LUM Protein, Human (HEK293, His) Product Image