Lymphocyte antigen 6H/LY6H Protein, Human (HEK293, His)

LY6H mediates the myelin trophic and neurotrophic effects of PSAP/Prosaposin protein through GPR37 and GPR37L1 receptors. Ligand-mediated internalization of these receptors results in ERK phosphorylation signaling. Lymphocyte antigen 6H/LY6H Protein, Human (HEK293, His) is the recombinant human-derived Lymphocyte antigen 6H/LY6H protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Lymphocyte antigen 6H/LY6H Protein, Human (HEK293, His) is 90 a.a., with molecular weight of ~18.0 kDa.

PSAP/Prosaposin protein acts as a myelinotrophic and neurotrophic factor, exerting its effects through G-protein-coupled receptors, GPR37 and GPR37L1, which undergo ligand-mediated internalization followed by ERK phosphorylation signaling. Furthermore, saposin-A and saposin-C, components of PSAP, stimulate the hydrolysis of glucosylceramide and galactosylceramide by their respective enzymes. Notably, saposin-C is proposed to combine with the enzyme and acidic lipid to form an activated complex, suggesting a mechanism of action that involves complex formation rather than substrate solubilization.

Human

HEK293

C-6*His

O94772 (L26-G115)

4062  [NCBI]

LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAG

Approximately 18.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.