Lymphocyte antigen 6H/LY6H Protein, Human (HEK293, His)
Based on 1 Customer Validation
LY6H mediates the myelin trophic and neurotrophic effects of PSAP/Prosaposin protein through GPR37 and GPR37L1 receptors. Ligand-mediated internalization of these receptors results in ERK phosphorylation signaling. Lymphocyte antigen 6H/LY6H Protein, Human (HEK293, His) is the recombinant human-derived Lymphocyte antigen 6H/LY6H protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
LY6H mediates the myelin trophic and neurotrophic effects of PSAP/Prosaposin protein through GPR37 and GPR37L1 receptors. Ligand-mediated internalization of these receptors results in ERK phosphorylation signaling. Lymphocyte antigen 6H/LY6H Protein, Human (HEK293, His) is the recombinant human-derived Lymphocyte antigen 6H/LY6H protein, expressed by HEK293 , with C-6*His labeled tag.
Background
PSAP/Prosaposin protein acts as a myelinotrophic and neurotrophic factor, exerting its effects through G-protein-coupled receptors, GPR37 and GPR37L1, which undergo ligand-mediated internalization followed by ERK phosphorylation signaling. Furthermore, saposin-A and saposin-C, components of PSAP, stimulate the hydrolysis of glucosylceramide and galactosylceramide by their respective enzymes. Notably, saposin-C is proposed to combine with the enzyme and acidic lipid to form an activated complex, suggesting a mechanism of action that involves complex formation rather than substrate solubilization.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
O94772 (L26-G115)
-
Molecular Construction
-
N-term
-
LY6H (L26-G115)
Accession # O94772 -
6*His
-
C-term
-
-
Protein Length
Full Length of Lymphocyte antigen 6H Chain
-
Synonyms
LY6H; Lymphocyte Antigen 6 Complex, Locus H; Lymphocyte Antigen 6 Family Member H; Lymphocyte Antigen 6H; NMLY6; Ly-6H
-
AA Sequence
LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAG
-
Predicted Molecular Mass
10.9 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
