MAGOH Protein, Human (His)
Based on 1 Customer Validation
MAGOH is an important spliceosome component that cooperates with MAGOHB to form the exon junction complex (EJC), which is central to pre-mRNA splicing and nonsense-mediated decay (NMD). EJC affects mRNA metabolism, marks exon-exon junctions, and affects processes such as mRNA export, localization, translation, and NMD. MAGOH Protein, Human (His) is the recombinant human-derived MAGOH protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
MAGOH is an important spliceosome component that cooperates with MAGOHB to form the exon junction complex (EJC), which is central to pre-mRNA splicing and nonsense-mediated decay (NMD). EJC affects mRNA metabolism, marks exon-exon junctions, and affects processes such as mRNA export, localization, translation, and NMD. MAGOH Protein, Human (His) is the recombinant human-derived MAGOH protein, expressed by E. coli , with C-6*His labeled tag.
MAGOH is an essential component of the spliceosome, contributing to pre-mRNA splicing processes. Acting redundantly with MAGOHB, it forms the core of the exon junction complex (EJC) and participates in the nonsense-mediated decay (NMD) pathway. The EJC is a dynamic structure involved in various aspects of mRNA metabolism, such as marking the exon-exon junction in mature mRNA and influencing downstream processes like nuclear mRNA export, subcellular mRNA localization, translation efficiency, and NMD. The MAGOH-RBM8A heterodimer, a key element of the EJC, inhibits the ATPase activity of EIF4A3, stabilizing the ATP-bound EJC core on spliced mRNA. This stable conformation interacts with the EJC regulator PYM1 in the cytoplasm, leading to EJC disassembly and enhancing translation of EJC-bearing spliced mRNAs by recruiting them to the ribosomal 48S preinitiation complex. MAGOH is also implicated in the splicing modulation of apoptotic genes, inhibiting the formation of proapoptotic isoforms like Bcl-X(S). In association with RBM8A, MAGOH is a core component of the mRNA splicing-dependent EJC and is identified in the spliceosome C complex.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P61326-1/NP_002361.1 (M1-I146)
-
Molecular Construction
-
N-term
-
MAGOH (M1-I146)
Accession # P61326-1/NP_002361.1 -
His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
MAGOH; Protein Mago Nashi Homolog; Mago Homolog, Exon Junction Complex Subunit; Mago-Nashi (Drosophila) Homolog, Proliferation-Associated; MAGOHA; Mago-Nashi Homolog, Proliferation-Associated (Drosophila); MAGOH1; Mago-Nashi Homolog, Proliferation-Associa
-
AA Sequence
MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 137 mM NaCl, 2.7 mM KCl, 10 mM Na2HPO4, 1.8 mM KH2PO4, 20% glycerol, pH 4.5.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)