MAGOH Protein, Human (His)

Customer Review

Based on 1 Customer Validation

MAGOH is an important spliceosome component that cooperates with MAGOHB to form the exon junction complex (EJC), which is central to pre-mRNA splicing and nonsense-mediated decay (NMD). EJC affects mRNA metabolism, marks exon-exon junctions, and affects processes such as mRNA export, localization, translation, and NMD. MAGOH Protein, Human (His) is the recombinant human-derived MAGOH protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

MAGOH is an important spliceosome component that cooperates with MAGOHB to form the exon junction complex (EJC), which is central to pre-mRNA splicing and nonsense-mediated decay (NMD). EJC affects mRNA metabolism, marks exon-exon junctions, and affects processes such as mRNA export, localization, translation, and NMD. MAGOH Protein, Human (His) is the recombinant human-derived MAGOH protein, expressed by E. coli , with C-6*His labeled tag.

Background

MAGOH is an essential component of the spliceosome, contributing to pre-mRNA splicing processes. Acting redundantly with MAGOHB, it forms the core of the exon junction complex (EJC) and participates in the nonsense-mediated decay (NMD) pathway. The EJC is a dynamic structure involved in various aspects of mRNA metabolism, such as marking the exon-exon junction in mature mRNA and influencing downstream processes like nuclear mRNA export, subcellular mRNA localization, translation efficiency, and NMD. The MAGOH-RBM8A heterodimer, a key element of the EJC, inhibits the ATPase activity of EIF4A3, stabilizing the ATP-bound EJC core on spliced mRNA. This stable conformation interacts with the EJC regulator PYM1 in the cytoplasm, leading to EJC disassembly and enhancing translation of EJC-bearing spliced mRNAs by recruiting them to the ribosomal 48S preinitiation complex. MAGOH is also implicated in the splicing modulation of apoptotic genes, inhibiting the formation of proapoptotic isoforms like Bcl-X(S). In association with RBM8A, MAGOH is a core component of the mRNA splicing-dependent EJC and is identified in the spliceosome C complex.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • MAGOH (M1-I146)
      Accession # P61326-1/NP_002361.1
    • His
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    MAGOH; Protein Mago Nashi Homolog; Mago Homolog, Exon Junction Complex Subunit; Mago-Nashi (Drosophila) Homolog, Proliferation-Associated; MAGOHA; Mago-Nashi Homolog, Proliferation-Associated (Drosophila); MAGOH1; Mago-Nashi Homolog, Proliferation-Associa

  • AA Sequence

    MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI

  • Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 137 mM NaCl, 2.7 mM KCl, 10 mM Na2HPO4, 1.8 mM KH2PO4, 20% glycerol, pH 4.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00