MARK4 Protein, Human (Active)
Based on 1 Customer Validation
MARK4 is a key serine/threonine protein kinase with crucial effects on cellular processes. It phosphorylates microtubule-associated proteins (MAPT/TAU, MAP2, MAP4) and reorganizes the microtubule network. MARK4 Protein, Human is the recombinant human-derived MARK4 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
MARK4 is a key serine/threonine protein kinase with crucial effects on cellular processes. It phosphorylates microtubule-associated proteins (MAPT/TAU, MAP2, MAP4) and reorganizes the microtubule network. MARK4 Protein, Human is the recombinant human-derived MARK4 protein, expressed by E. coli , with tag free.
MARK4, a serine/threonine-protein kinase, plays a crucial role in diverse cellular processes. It phosphorylates microtubule-associated proteins, including MAPT/TAU, MAP2, and MAP4, leading to the reorganization of the microtubule network into bundles. Essential for the initiation of axoneme extension during cilium assembly, MARK4 regulates the centrosomal location of ODF2. Additionally, it contributes to cell cycle progression at the G1/S checkpoint and is implicated in neuronal cell survival. Beyond its cellular functions, MARK4 influences energy homeostasis by modulating satiety and metabolic rate. It promotes adipogenesis through JNK1 activation, inhibits the p38MAPK pathway, and triggers apoptosis via JNK1 activation. Furthermore, MARK4 negatively regulates the mTORC1 complex by phosphorylating RPTOR, disrupting its interaction with the RRAGA/RRAGC heterodimer essential for mTORC1 activation. In the context of inflammasome activation, MARK4 participates in NLRP3 positioning along microtubules, mediating its recruitment to the microtubule organizing center.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q96L34 (N44-K370)
-
Gene ID57787
-
Molecular Construction
-
N-term
-
MARK4 (N44-K370)
Accession # Q96L34 -
C-term
-
-
Protein Length
Partial
-
Synonyms
MARK4; MAP/microtubule affinity-regulating kinase 4; MAP/microtubule affinity-regulating kinase-like 1
-
AA Sequence
NSIASCPEEQPHVGNYRLLRTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPSSLQKLFREVRIMKGLNHPNIVKLFEVIETEKTLYLVMEYASAGEVFDYLVSHGRMKEKEARAKFRQIVSAVHYCHQKNIVHRDLKAENLLLDAEANIKIADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDIWSLGVILYTLVSGSLPFDGHNLKELRERVLRGKYRVPFYMSTDCESILRRFLVLNPAKRCTLEQIMKDKWINIGYEGEELKPYTEPEEDFGDTKRIEVMVGMGYTREEIKESLTSQKYNEVTATYLLLGRK
-
Molecular Weight
Approximately 37 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 5% glycerol, 1 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)