MASP2 Protein, Mouse (His)
MASP2 Protein, a serum protease, plays a pivotal role in activating the complement system by cleaving C2 and C4 upon auto-catalytic cleavage.This activation leads to the formation of C3 convertase, a crucial step in initiating the complement cascade through mannose-binding lectin.MASP2 Protein, Mouse (His) is the recombinant mouse-derived MASP2 protein, expressed by E.coli , with C-His labeled tag.
- Species: Mouse
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
MASP2 Protein, a serum protease, plays a pivotal role in activating the complement system by cleaving C2 and C4 upon auto-catalytic cleavage.This activation leads to the formation of C3 convertase, a crucial step in initiating the complement cascade through mannose-binding lectin.MASP2 Protein, Mouse (His) is the recombinant mouse-derived MASP2 protein, expressed by E.coli , with C-His labeled tag.
MASP2 is a serum protease crucial for the activation of the complement system through mannose-binding lectin. Upon auto-catalytic cleavage, MASP2 effectively cleaves C2 and C4, resulting in their activation and subsequent formation of C3 convertase, which is vital for the complement cascade.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag C-6*His
-
Accession
Q91WP0 (T287-F685)
-
Molecular Construction
-
N-term
-
MASP2 (T287-F685)
Accession # Q91WP0 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
MASP2; Mannan-Binding Lectin Serine Protease 1 Pseudogene 1; Prev. MASP1P1; Mannose-Binding Lectin Associated Protein 19; Mannan-Binding Lectin Serine Protease 2; MBL-Associated Serine Protease 2; Mannose-Binding Protein-Associated Serine Protease 2; MASP
-
AA Sequence
TGWKIHYTSTARPCPDPTAPPNGSISPVQAIYVLKDRFSVFCKTGFELLQGSVPLKSFTAVCQKDGSWDRPMPECSIIDCGPPDDLPNGHVDYITGPEVTTYKAVIQYSCEETFYTMSSNGKYVCEADGFWTSSKGEKLPPVCEPVCGLSTHTIGGRIVGGQPAKPGDFPWQVLLLGQTTAAAGALIHDNWVLTAAHAVYEKRMAASSLNIRMGILKRLSPHYTQAWPEEIFIHEGYTHGAGFDNDIALIKLKNKVTINGSIMPVCLPRKEAASLMRTDFTGTVAGWGLTQKGLLARNLMFVDIPIADHQKCTAVYEKLYPGVRVSANMLCAGLETGGKDSCRGDSGGALVFLDNETQRWFVGGIVSWGSINCGAADQYGVYTKVINYIPWIENIISNF
-
Predicted Molecular Mass
46.6 kDa
-
Molecular Weight
Approximately 18-20 kDa & 27-30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
