MD-2/LY96 Protein, Mouse (HEK293, Fc)
Based on 1 Customer Validation
MD-2/LY96 Protein, acting as a monomer, robustly and specifically binds to interleukin-13 (IL13), distinguishing it from interleukin-4 (IL4) with which it does not interact.This selective binding highlights MD-2/LY96's pivotal role in mediating cellular responses to IL13, underscoring its significance in IL13-related biological activities.MD-2/LY96 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived MD-2/LY96 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MD-2/LY96 Protein, acting as a monomer, robustly and specifically binds to interleukin-13 (IL13), distinguishing it from interleukin-4 (IL4) with which it does not interact.This selective binding highlights MD-2/LY96's pivotal role in mediating cellular responses to IL13, underscoring its significance in IL13-related biological activities.MD-2/LY96 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived MD-2/LY96 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
IL-13R alpha 2, functioning as a monomer, exhibits a robust and specific binding affinity for interleukin-13 (IL13), distinguishing it from interleukin-4 (IL4), to which it does not bind. This selective interaction underscores IL-13R alpha 2's role in mediating cellular responses to IL13, emphasizing its importance in the context of IL13-related biological activities.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When recombinant human TLR-4 is Immobilized at 2 µg/mL (100 µL/well), can bind Biotinylated MD-2. The ED50 for this effect is 1.491 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
Q9JHF9 (E19-N160)
-
Molecular Construction
-
N-term
-
LY96 (E19-N160)
Accession # Q9JHF9 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
LY96; Ly-96; Lymphocyte Antigen 96; MD2; MD-2; Myeloid Differentiation Protein-2; Protein MD-2; MD-2 Mimetic Protein Variant; ESOP-1; ESOP1
-
AA Sequence
EKQQWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPRGNLKYLYFNLFISVNSIELPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIHRRDVN
-
Molecular Weight
Approximately 47 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
