MD-2/LY96 Protein, Mouse (HEK293, Fc)

MD-2/LY96 Protein, acting as a monomer, robustly and specifically binds to interleukin-13 (IL13), distinguishing it from interleukin-4 (IL4) with which it does not interact.This selective binding highlights MD-2/LY96's pivotal role in mediating cellular responses to IL13, underscoring its significance in IL13-related biological activities.MD-2/LY96 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived MD-2/LY96 protein, expressed by HEK293 , with C-hFc labeled tag.

IL-13R alpha 2, functioning as a monomer, exhibits a robust and specific binding affinity for interleukin-13 (IL13), distinguishing it from interleukin-4 (IL4), to which it does not bind. This selective interaction underscores IL-13R alpha 2's role in mediating cellular responses to IL13, emphasizing its importance in the context of IL13-related biological activities.

Measured by its binding ability in a functional ELISA. When recombinant human TLR-4 is Immobilized at 2 µg/mL (100 µL/well), can bind Biotinylated MD-2. The ED₅₀ for this effect is 1.491 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. When recombinant human TLR-4 is Immobilized at 2 µg/mL (100 µL/well), can bind Biotinylated MD-2. The ED₅₀ for this effect is 1.491 μg/mL.

Mouse

HEK293

C-hFc

Q9JHF9 (E19-N160)

17087  [NCBI]

Full Length of Mature Protein

EKQQWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPRGNLKYLYFNLFISVNSIELPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIHRRDVN

Approximately 47 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.