MDK/Midkine Protein, Human (Biotinylated, His-Avi)
Midkine (MDK) protein is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors. MDK regulates inflammatory responses, cell proliferation, adhesion, growth, survival, tissue regeneration, differentiation, and migration and plays a crucial role in inflammation by recruiting neutrophils and macrophages. MDK/Midkine Protein, Human (Biotinylated, His-Avi) is the recombinant human-derived MDK/Midkine protein, expressed by E. coli , with C-Avi, N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
Midkine (MDK) protein is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors. MDK regulates inflammatory responses, cell proliferation, adhesion, growth, survival, tissue regeneration, differentiation, and migration and plays a crucial role in inflammation by recruiting neutrophils and macrophages. MDK/Midkine Protein, Human (Biotinylated, His-Avi) is the recombinant human-derived MDK/Midkine protein, expressed by E. coli , with C-Avi, N-His labeled tag.
Background
Midkine (MDK) is a secreted protein that serves as a multifunctional cytokine and growth factor, transmitting signals through cell-surface proteoglycan and non-proteoglycan receptors. Engaging in various physiological processes, MDK regulates inflammatory responses, cell proliferation, adhesion, growth, survival, tissue regeneration, differentiation, and migration. It plays a crucial role in inflammatory processes by mediating the recruitment of neutrophils and macrophages to inflammation sites, exhibiting dual activities that include promoting epithelial cell survival and facilitating smooth muscle cell migration following renal and vessel damage. Moreover, MDK suppresses the development of tolerogenic dendritic cells, inhibiting regulatory T cell differentiation and promoting T cell expansion through NFAT signaling and Th1 cell differentiation. MDK's involvement extends to tissue regeneration, contributing to heart damage recovery by negatively regulating inflammatory cell recruitment and mediating cell survival through MAPKs and AKT pathways, along with facilitating liver regeneration, bone repair, and brain development. Interactions with various receptors, such as PTPRZ1, ITGA4:ITGB1 complex, LRP1, and GPC2, underscore MDK's intricate regulatory role in diverse physiological processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-Avi;N-8*His
-
Accession
P21741-1 (V21-D143)
-
Molecular Construction
-
N-term
-
8*His-Avi
-
MDK (V21-D143)
Accession # P21741-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Conjugation
Biotin
-
Synonyms
MDK; Midgestation And Kidney Protein; Prev. NEGF2; ARAP; MK; Neurite Outgrowth-Promoting Protein; Neurite Outgrowth-Promoting Factor 2; Retinoic Acid Inducible Factor; Neurite Growth-Promoting Factor 2; Mutant Truncated Midkine B; Amphiregulin-Associated
-
AA Sequence
VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
-
Predicted Molecular Mass
16.5 kDa
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)