MDK/Midkine Protein, Human (sf9)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Midkine (MDK) protein is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors. MDK regulates inflammatory responses, cell proliferation, adhesion, growth, survival, tissue regeneration, differentiation, and migration and plays a crucial role in inflammation by recruiting neutrophils and macrophages. MDK/Midkine Protein, Human (sf9) is the recombinant human-derived MDK protein, expressed by Sf9 insect cells , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Midkine (MDK) protein is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors. MDK regulates inflammatory responses, cell proliferation, adhesion, growth, survival, tissue regeneration, differentiation, and migration and plays a crucial role in inflammation by recruiting neutrophils and macrophages. MDK/Midkine Protein, Human (sf9) is the recombinant human-derived MDK protein, expressed by Sf9 insect cells , with tag free.

Background

Midkine (MDK) is a secreted protein that serves as a multifunctional cytokine and growth factor, transmitting signals through cell-surface proteoglycan and non-proteoglycan receptors. Engaging in various physiological processes, MDK regulates inflammatory responses, cell proliferation, adhesion, growth, survival, tissue regeneration, differentiation, and migration. It plays a crucial role in inflammatory processes by mediating the recruitment of neutrophils and macrophages to inflammation sites, exhibiting dual activities that include promoting epithelial cell survival and facilitating smooth muscle cell migration following renal and vessel damage. Moreover, MDK suppresses the development of tolerogenic dendritic cells, inhibiting regulatory T cell differentiation and promoting T cell expansion through NFAT signaling and Th1 cell differentiation. MDK's involvement extends to tissue regeneration, contributing to heart damage recovery by negatively regulating inflammatory cell recruitment and mediating cell survival through MAPKs and AKT pathways, along with facilitating liver regeneration, bone repair, and brain development. Interactions with various receptors, such as PTPRZ1, ITGA4:ITGB1 complex, LRP1, and GPC2, underscore MDK's intricate regulatory role in diverse physiological processes.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human MDK at 2 μg/mL (100 μL/well) can bind Biotinylated Human LRP-6. The ED50 for this effect is 21.63 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Human MDK at 2 μg/mL (100 μL/well) can bind Biotinylated Human LRP-6. The ED50 for this effect is 21.63 ng/mL.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • MDK (V21-D143)
      Accession # P21741-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    MDK; Midgestation And Kidney Protein; Prev. NEGF2; ARAP; MK; Neurite Outgrowth-Promoting Protein; Neurite Outgrowth-Promoting Factor 2; Retinoic Acid Inducible Factor; Neurite Growth-Promoting Factor 2; Mutant Truncated Midkine B; Amphiregulin-Associated

  • AA Sequence

    VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

  • Predicted Molecular Mass

    13.4 kDa

  • Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Structure/Form

    Homodimer

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM PBS, 1 M NaCl, pH 6.8, 5% trehalose, 5% mannitol and 0.01% Tween 80.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM PB, 1 M NaCl, pH 6.8, 5% trehalose, 5% Mannitol, 0.01% Tween 80.
3.Lyophilized from a 0.22 μm filtered solution of 50 mM PB, 1 M NaCl, 10% glycerol, pH 6.8, 5% trehalose, 5% Mannitol, 0.01% Tween-80.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00