1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins CAMK
  4. CAMKL
  5. MELK
  6. MELK Protein, Human (His)

MELK is a multifunctional serine/threonine protein kinase that regulates the cell cycle, stem cell self-renewal, apoptosis, and splicing. MELK phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622, activates apoptosis through MAP3K5/ASK1, helps CDC25B localize during mitosis, and inhibits BCL2L14, which may affect breast cancer occurrence. MELK Protein, Human (His) is the recombinant human-derived MELK protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MELK is a multifunctional serine/threonine protein kinase that regulates the cell cycle, stem cell self-renewal, apoptosis, and splicing. MELK phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622, activates apoptosis through MAP3K5/ASK1, helps CDC25B localize during mitosis, and inhibits BCL2L14, which may affect breast cancer occurrence. MELK Protein, Human (His) is the recombinant human-derived MELK protein, expressed by E. coli , with N-6*His labeled tag.

Background

MELK, a serine/threonine-protein kinase, orchestrates a diverse array of cellular processes encompassing cell cycle regulation, stem cell self-renewal, apoptosis, and splicing control. Exhibiting a broad substrate specificity, MELK phosphorylates key proteins such as BCL2L14, CDC25B, MAP3K5/ASK1, and ZNF622. As an activator of apoptosis, MELK phosphorylates and activates MAP3K5/ASK1. In the realm of cell cycle regulation, MELK assumes a pivotal role by mediating the phosphorylation of CDC25B, facilitating its localization to the centrosome and spindle poles during mitosis. This kinase is indispensable for the proliferation of both embryonic and postnatal multipotent neural progenitors. MELK's impact on carcinogenesis extends to the phosphorylation and inhibition of BCL2L14, potentially influencing mammary carcinogenesis by impeding the pro-apoptotic function of BCL2L14. Moreover, MELK contributes to the inhibition of spliceosome assembly during mitosis through the phosphorylation of ZNF622, redirecting its localization to the nucleus. Notably, MELK's involvement in primitive hematopoiesis underscores its multifaceted regulatory role in fundamental cellular processes.

Biological Activity

The kinase activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q14680 (D3-V330)

Gene ID

9833

Molecular Construction
N-term
6*His
MELK (D3-V330)
Accession # Q14680
C-term
Protein Length

Partial

Synonyms
MELK; Maternal embryonic leucine zipper kinase; hMELK; Protein kinase Eg3; pEg3 kinase; Protein kinase PK38; hPK38; Tyrosine-protein kinase MELK
AA Sequence

DYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPV

Molecular Weight

39.7 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 200 mM NaCl, 20% glycerol, 1 mM DTT, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MELK Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MELK Protein, Human (His)
Cat. No.:
HY-P701811
Quantity:
MCE Japan Authorized Agent: