MELK Protein, Human (His)
Based on 1 Customer Validation
MELK is a multifunctional serine/threonine protein kinase that regulates the cell cycle, stem cell self-renewal, apoptosis, and splicing. MELK phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622, activates apoptosis through MAP3K5/ASK1, helps CDC25B localize during mitosis, and inhibits BCL2L14, which may affect breast cancer occurrence. MELK Protein, Human (His) is the recombinant human-derived MELK protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
MELK is a multifunctional serine/threonine protein kinase that regulates the cell cycle, stem cell self-renewal, apoptosis, and splicing. MELK phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622, activates apoptosis through MAP3K5/ASK1, helps CDC25B localize during mitosis, and inhibits BCL2L14, which may affect breast cancer occurrence. MELK Protein, Human (His) is the recombinant human-derived MELK protein, expressed by E. coli , with N-6*His labeled tag.
MELK, a serine/threonine-protein kinase, orchestrates a diverse array of cellular processes encompassing cell cycle regulation, stem cell self-renewal, apoptosis, and splicing control. Exhibiting a broad substrate specificity, MELK phosphorylates key proteins such as BCL2L14, CDC25B, MAP3K5/ASK1, and ZNF622. As an activator of apoptosis, MELK phosphorylates and activates MAP3K5/ASK1. In the realm of cell cycle regulation, MELK assumes a pivotal role by mediating the phosphorylation of CDC25B, facilitating its localization to the centrosome and spindle poles during mitosis. This kinase is indispensable for the proliferation of both embryonic and postnatal multipotent neural progenitors. MELK's impact on carcinogenesis extends to the phosphorylation and inhibition of BCL2L14, potentially influencing mammary carcinogenesis by impeding the pro-apoptotic function of BCL2L14. Moreover, MELK contributes to the inhibition of spliceosome assembly during mitosis through the phosphorylation of ZNF622, redirecting its localization to the nucleus. Notably, MELK's involvement in primitive hematopoiesis underscores its multifaceted regulatory role in fundamental cellular processes.
The kinase activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q14680 (D3-V330)
-
Gene ID9833
-
Molecular Construction
-
N-term
-
6*His
-
MELK (D3-V330)
Accession # Q14680 -
C-term
-
-
Protein Length
Partial
-
Synonyms
MELK; Protein Kinase Eg3; Maternal Embryonic Leucine Zipper Kinase; PEg3 Kinase; KIAA0175; HPK38; Tyrosine-Protein Kinase MELK; Non-Specific Serine/Threonine Protein Kinase; Protein Kinase PK38; HMELK
-
AA Sequence
DYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPV
-
Predicted Molecular Mass
39.7 kDa
-
Molecular Weight
Approximately 35-38 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 200 mM NaCl, 20% glycerol, 1 mM DTT, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)