MELK Protein, Human (Active)

MELK is a multifunctional serine/threonine protein kinase that regulates the cell cycle, stem cell self-renewal, apoptosis, and splicing. MELK phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622, activates apoptosis through MAP3K5/ASK1, helps CDC25B localize during mitosis, and inhibits BCL2L14, which may affect breast cancer occurrence. MELK Protein, Human is the recombinant human-derived MELK protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Biological Activity
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

MELK is a multifunctional serine/threonine protein kinase that regulates the cell cycle, stem cell self-renewal, apoptosis, and splicing. MELK phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622, activates apoptosis through MAP3K5/ASK1, helps CDC25B localize during mitosis, and inhibits BCL2L14, which may affect breast cancer occurrence. MELK Protein, Human is the recombinant human-derived MELK protein, expressed by E. coli , with tag free.

Background

MELK, a serine/threonine-protein kinase, orchestrates a diverse array of cellular processes encompassing cell cycle regulation, stem cell self-renewal, apoptosis, and splicing control. Exhibiting a broad substrate specificity, MELK phosphorylates key proteins such as BCL2L14, CDC25B, MAP3K5/ASK1, and ZNF622. As an activator of apoptosis, MELK phosphorylates and activates MAP3K5/ASK1. In the realm of cell cycle regulation, MELK assumes a pivotal role by mediating the phosphorylation of CDC25B, facilitating its localization to the centrosome and spindle poles during mitosis. This kinase is indispensable for the proliferation of both embryonic and postnatal multipotent neural progenitors. MELK's impact on carcinogenesis extends to the phosphorylation and inhibition of BCL2L14, potentially influencing mammary carcinogenesis by impeding the pro-apoptotic function of BCL2L14. Moreover, MELK contributes to the inhibition of spliceosome assembly during mitosis through the phosphorylation of ZNF622, redirecting its localization to the nucleus. Notably, MELK's involvement in primitive hematopoiesis underscores its multifaceted regulatory role in fundamental cellular processes.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • MELK (D3-V330)
      Accession # Q14680
    • C-term
  • Protein Length

    Partial

  • Synonyms

    MELK; Protein Kinase Eg3; Maternal Embryonic Leucine Zipper Kinase; PEg3 Kinase; KIAA0175; HPK38; Tyrosine-Protein Kinase MELK; Non-Specific Serine/Threonine Protein Kinase; Protein Kinase PK38; HMELK

  • AA Sequence

    DYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPV

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00