MFAP4 Protein, Cynomolgus (HEK293, His)
MFAP4 is part of the microfibril-associated glycoprotein (MFAP) family and is involved in cell adhesion, cell-cell interactions, and the assembly and/or maintenance of elastic fibers. MFAP4 deficiency alleviates renal fibrosis by inhibiting NF-κB and TGF-β/Smad signaling pathways. MFAP4 is a novel biomarker for human cancer. MFAP4 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived MFAP4 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MFAP4 is part of the microfibril-associated glycoprotein (MFAP) family and is involved in cell adhesion, cell-cell interactions, and the assembly and/or maintenance of elastic fibers. MFAP4 deficiency alleviates renal fibrosis by inhibiting NF-κB and TGF-β/Smad signaling pathways. MFAP4 is a novel biomarker for human cancer. MFAP4 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived MFAP4 protein, expressed by HEK293 , with C-His labeled tag.
Background
MFAP4 is part of the microfibril-associated glycoprotein (MFAP) family and is involved in cell adhesion, cell-cell interactions, and the assembly and/or maintenance of elastic fibers. MFAP4 deficiency alleviates renal fibrosis by inhibiting NF-κB and TGF-β/Smad signaling pathways. MFAP4 can promote the migration and proliferation of vascular smooth muscle and accelerate the formation of new intima. MFAP4 could also serve as a novel biomarker for the development of human cancer therapies[1][2][3].
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-8*His
-
Accession
A0A2K5TQS8 (V60-A293)
-
Gene ID/
-
Molecular Construction
-
N-term
-
MFAP4 (V60-A293)
Accession # A0A2K5TQS8 -
8*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
MFAP4; Microfibril-Associated Glycoprotein 4; Microfibril Associated Protein 4; Microfibrillar Associated Protein 4
-
AA Sequence
VSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPLGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEEDGYTLYVAGFEDGGAGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA
-
Predicted Molecular Mass
27.6 kDa
-
Molecular Weight
Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
