1. Recombinant Proteins
  2. Others
  3. MFAP4 Protein, Cynomolgus (HEK293, His)

MFAP4 is part of the microfibril-associated glycoprotein (MFAP) family and is involved in cell adhesion, cell-cell interactions, and the assembly and/or maintenance of elastic fibers. MFAP4 deficiency alleviates renal fibrosis by inhibiting NF-κB and TGF-β/Smad signaling pathways. MFAP4 is a novel biomarker for human cancer. MFAP4 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived MFAP4 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MFAP4 is part of the microfibril-associated glycoprotein (MFAP) family and is involved in cell adhesion, cell-cell interactions, and the assembly and/or maintenance of elastic fibers. MFAP4 deficiency alleviates renal fibrosis by inhibiting NF-κB and TGF-β/Smad signaling pathways. MFAP4 is a novel biomarker for human cancer. MFAP4 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived MFAP4 protein, expressed by HEK293 , with C-His labeled tag.

Background

MFAP4 is part of the microfibril-associated glycoprotein (MFAP) family and is involved in cell adhesion, cell-cell interactions, and the assembly and/or maintenance of elastic fibers. MFAP4 deficiency alleviates renal fibrosis by inhibiting NF-κB and TGF-β/Smad signaling pathways. MFAP4 can promote the migration and proliferation of vascular smooth muscle and accelerate the formation of new intima. MFAP4 could also serve as a novel biomarker for the development of human cancer therapies[1][2][3].

Species

Cynomolgus

Source

HEK293

Tag

C-8*His

Accession

A0A2K5TQS8 (V60-A293)

Gene ID

/

Molecular Construction
N-term
MFAP4 (V60-A293)
Accession # A0A2K5TQS8
8*His
C-term
Protein Length

Partial

Synonyms
Microfibril-associated glycoprotein 4; Mfap4
AA Sequence

VSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPLGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEEDGYTLYVAGFEDGGAGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA

Predicted Molecular Mass
27.6 kDa
Molecular Weight

Approximately 35-40 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

MFAP4 Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MFAP4 Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MFAP4 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P700873
Quantity:
MCE Japan Authorized Agent: